BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_E15 (624 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0746 - 19888479-19888622,19888739-19888867,19889061-198895... 30 1.3 >09_04_0746 - 19888479-19888622,19888739-19888867,19889061-19889548, 19889666-19889843,19889920-19889991,19890993-19891193 Length = 403 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -1 Query: 213 TNTFQSVKYRSVTKAAPPNPPAEDRNAVAISKCXLP 106 TN FQS + S T PP PP D + + +SK LP Sbjct: 41 TNPFQSAAFSSTTTGDPP-PPTMD-SPIKVSKIILP 74 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,199,744 Number of Sequences: 37544 Number of extensions: 255439 Number of successful extensions: 564 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 555 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 564 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1513903616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -