Bombyx BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P01_F_E15
         (624 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_33996| Best HMM Match : 7tm_1 (HMM E-Value=5.2e-09)                 28   5.4  

>SB_33996| Best HMM Match : 7tm_1 (HMM E-Value=5.2e-09)
          Length = 537

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 1/51 (1%)
 Frame = +1

Query: 361 IYEYYFICTLTNQL*NLRFSL-SMCTSKTYNLWRPLLLFVITIVSCSFNEY 510
           I  ++  C L + L N   SL   C   T + W   L F+ T+V+CS N++
Sbjct: 368 ILAFFTFCLLPSCLMNYVISLCESCDCSTVH-WLRDLQFLFTLVNCSSNQF 417


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,214,496
Number of Sequences: 59808
Number of extensions: 314616
Number of successful extensions: 429
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 419
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 429
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1548368000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)