BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_E14 (679 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14756| Best HMM Match : PIG-U (HMM E-Value=4.3) 32 0.37 SB_39464| Best HMM Match : 7tm_1 (HMM E-Value=4e-39) 29 2.6 >SB_14756| Best HMM Match : PIG-U (HMM E-Value=4.3) Length = 194 Score = 32.3 bits (70), Expect = 0.37 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +3 Query: 453 IGIITVSENYFRKFHTTLFLSI*KQFIIQHLYFFVTNILINFHLLYY 593 +GIIT + Y F ++ +I ++ I L FF++ I IN LL Y Sbjct: 63 VGIITGIKPYIAFFFIPVWSAIADKYRISRLLFFISTIAINLGLLSY 109 >SB_39464| Best HMM Match : 7tm_1 (HMM E-Value=4e-39) Length = 375 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +3 Query: 564 ILINFHLLYYTTYYVKTIQNYRPLLTYY 647 ILI + LLY TY V + N LLT Y Sbjct: 28 ILIGYSLLYLVTYIVAVLGNIMALLTCY 55 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,972,958 Number of Sequences: 59808 Number of extensions: 296848 Number of successful extensions: 519 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 518 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -