BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_E14 (679 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC009828-1|AAH09828.1| 394|Homo sapiens LAG1 homolog, ceramide ... 30 6.6 AK222621-1|BAD96341.1| 394|Homo sapiens LAG1 longevity assuranc... 30 6.6 AK022151-1|BAB13972.1| 394|Homo sapiens protein ( Homo sapiens ... 30 6.6 >BC009828-1|AAH09828.1| 394|Homo sapiens LAG1 homolog, ceramide synthase 4 (S. cerevisiae) protein. Length = 394 Score = 30.3 bits (65), Expect = 6.6 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +3 Query: 528 FIIQHLYFFVTNILINFHLLYYTTYYVKTIQNYRPLLTYY 647 F+I FF T +++ + YTTYY ++I N P YY Sbjct: 265 FLIFSFVFFYTRLVLFPTQILYTTYY-ESISNRGPFFGYY 303 >AK222621-1|BAD96341.1| 394|Homo sapiens LAG1 longevity assurance homolog 4 variant protein. Length = 394 Score = 30.3 bits (65), Expect = 6.6 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +3 Query: 528 FIIQHLYFFVTNILINFHLLYYTTYYVKTIQNYRPLLTYY 647 F+I FF T +++ + YTTYY ++I N P YY Sbjct: 265 FLIFSFVFFYTRLVLFPTQILYTTYY-ESISNRGPFFGYY 303 >AK022151-1|BAB13972.1| 394|Homo sapiens protein ( Homo sapiens cDNA FLJ12089 fis, clone HEMBB1002550, weakly similar to HYPOTHETICAL UOG-1 PROTEIN. ). Length = 394 Score = 30.3 bits (65), Expect = 6.6 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +3 Query: 528 FIIQHLYFFVTNILINFHLLYYTTYYVKTIQNYRPLLTYY 647 F+I FF T +++ + YTTYY ++I N P YY Sbjct: 265 FLIFSFVFFYTRLVLFPTQILYTTYY-ESISNRGPFFGYY 303 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,772,355 Number of Sequences: 237096 Number of extensions: 1400831 Number of successful extensions: 1937 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1901 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1937 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7671262118 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -