BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_E09 (461 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0057 + 476172-476283,476337-476449,476532-476634,477089-47... 28 4.2 07_01_1104 - 10160493-10160599,10160632-10160637,10160930-101609... 27 9.7 >03_01_0057 + 476172-476283,476337-476449,476532-476634,477089-477210, 477303-477497,477627-477701,478082-478179,478328-478421 Length = 303 Score = 27.9 bits (59), Expect = 4.2 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = +1 Query: 172 TMNPWRLFINLFRMKLKNSCYARSLKPTPPKQKHRQN 282 TM W++FI F + + C+ + +K + + H +N Sbjct: 250 TMKHWQVFILFFELFTASVCFGKRIKHSSISEGHDEN 286 >07_01_1104 - 10160493-10160599,10160632-10160637,10160930-10160975, 10161053-10161190,10161275-10161679,10163193-10163330, 10163401-10163482,10163596-10163943,10164294-10164655, 10165154-10165209,10166428-10166558,10166564-10166628, 10169191-10169631 Length = 774 Score = 26.6 bits (56), Expect = 9.7 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = -1 Query: 197 INRRQGFIVPAGHSAGDGSPLSTPAGCESELGFGHYEASQNKE*NREFVHFWL 39 +N G++ P +SAGD TP ++ G ASQ+ N + FWL Sbjct: 167 LNLDYGYVYPMFYSAGDLLATGTPKVHVNQKNTGSVNASQDIL-NLDETGFWL 218 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,469,947 Number of Sequences: 37544 Number of extensions: 218715 Number of successful extensions: 595 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 595 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 919380308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -