BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_E07 (694 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 3.6 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 21 8.4 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 8.4 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.6 bits (46), Expect = 3.6 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +3 Query: 543 LDMLILDRILQAPGEHLVVPSMVKARLSE*VHNMVLTLTGKQVKVSLFI 689 LD + IL PG+HL V + ++ L E + V T V + L I Sbjct: 741 LDDIASMEILYKPGDHLGVFACNRSELVEAILKRVQTPFDPDVPIELQI 789 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 450 HDTS*LPERGEVKKC 406 H+ LPERGE+ C Sbjct: 303 HEFQILPERGELGHC 317 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = -3 Query: 311 GEPASDYCYHQRPQPPSQTAVLIQTHTLHHANEV 210 G PA+ Q P S A+ H HH E+ Sbjct: 446 GSPATTAAPPQLPTEESVDALCNTLHHWHHCPEI 479 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,430 Number of Sequences: 438 Number of extensions: 3777 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -