BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_E06 (637 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 2.5 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 7.6 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.0 bits (47), Expect = 2.5 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -3 Query: 590 YDHQHYQWSYLAHCHRVPSHQGQHG 516 + HQH+ Y H HR S QHG Sbjct: 317 HPHQHHPSQY--HPHRGSSPHHQHG 339 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.4 bits (43), Expect = 7.6 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = +2 Query: 5 RPLVHQFLSLSQSHWPLSVVCKCXRFFLSNCFLIXNL 115 RP Q+ + Q + K RFF FLI N+ Sbjct: 340 RPATVQYDTCCQGRATAIYIDKVSRFFFPFSFLILNV 376 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,308 Number of Sequences: 438 Number of extensions: 3559 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -