BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_E05 (631 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC664.05 |rpl13||60S ribosomal protein L13|Schizosaccharomyces... 179 4e-46 SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pomb... 28 0.97 SPAC23C4.02 |crn1||actin binding protein, coronin Crn1|Schizosac... 26 3.9 SPAC2F3.12c |||conserved eukaryotic protein|Schizosaccharomyces ... 25 6.8 SPCC1322.14c |vtc4||vacuolar transporter chaperone |Schizosaccha... 25 9.0 >SPAC664.05 |rpl13||60S ribosomal protein L13|Schizosaccharomyces pombe|chr 1|||Manual Length = 208 Score = 179 bits (435), Expect = 4e-46 Identities = 94/188 (50%), Positives = 122/188 (64%), Gaps = 1/188 (0%) Frame = +1 Query: 67 IPNGHFHKDWQRFVKTWFNQPARRYRRKQNRIXXXXXXXXXXXXXXLRPIVRCPTVRYHT 246 +PN HFHKDWQR+VKTWFNQP R+ RR+Q R +RP V+ PT+RY+ Sbjct: 9 LPNAHFHKDWQRYVKTWFNQPGRKLRRRQAR-QTKAAKIAPRPVEAIRPAVKPPTIRYNM 67 Query: 247 KVRAGRGFTLREIRAAGLNPVFARTIGIAVDPRRRNKSVESLQINVQRIKEYRARLILFP 426 KVRAGRGFTL E++AAG++ A TIGI VD RRRN+S ESLQ NV+RIK Y A LI+FP Sbjct: 68 KVRAGRGFTLEELKAAGVSRRVASTIGIPVDHRRRNRSEESLQRNVERIKVYLAHLIVFP 127 Query: 427 -KGKKVLKGEANEEERKLATQLRGPLMPVQQPAPKSVARPITEDEKNFKAYQYLRGARSI 603 K + KG+A + T + ++P+ Q A + A+PITE+ KNF A+ L R+ Sbjct: 128 RKAGQPKKGDATDVSGAEQTDV-AAVLPITQEAVEE-AKPITEEAKNFNAFSTLSNERAY 185 Query: 604 AKLVGIRA 627 A+ G RA Sbjct: 186 ARYAGARA 193 >SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pombe|chr 2|||Manual Length = 1283 Score = 28.3 bits (60), Expect = 0.97 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = -2 Query: 279 TKSESSTGAYFSM----VPNSWASHYRT*RPSCRTWSYGLSFLY 160 T +STG+Y M + W S T C TWSY S+ Y Sbjct: 1215 TVQGTSTGSYICMPHFQIQYDWCSAGVTDMSECNTWSYQKSYDY 1258 >SPAC23C4.02 |crn1||actin binding protein, coronin Crn1|Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 26.2 bits (55), Expect = 3.9 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +1 Query: 445 KGEANEEERKLATQLRGPLMPVQQPAPKSVARPITEDE 558 + E N ++ + TQ + PV++ PK + P+T E Sbjct: 470 RDEDNHQKEETVTQPKREKTPVEKSFPKPASSPVTFSE 507 >SPAC2F3.12c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 279 Score = 25.4 bits (53), Expect = 6.8 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 260 VEDSLFVKLGPQD*TQYLPERLELL 334 +ED+LF +L D T Y +RLE+L Sbjct: 95 LEDALFSQLDEFDDTAYREQRLEML 119 >SPCC1322.14c |vtc4||vacuolar transporter chaperone |Schizosaccharomyces pombe|chr 3|||Manual Length = 721 Score = 25.0 bits (52), Expect = 9.0 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 71 LMDISTRIGKDLLKLGLTSQLDDTAES 151 L+DIS R G+D L S+L D +S Sbjct: 556 LLDISKRKGRDSFVAALNSRLKDIKDS 582 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,611,567 Number of Sequences: 5004 Number of extensions: 52948 Number of successful extensions: 141 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 139 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 279695522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -