BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_E05 (631 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19135| Best HMM Match : Ribosomal_L13e (HMM E-Value=0) 207 5e-54 SB_12085| Best HMM Match : TBP (HMM E-Value=3.5e-35) 34 0.11 SB_50893| Best HMM Match : SH3_1 (HMM E-Value=2e-33) 29 3.1 SB_54753| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_47063| Best HMM Match : APOBEC_C (HMM E-Value=0.41) 28 5.4 SB_16060| Best HMM Match : Protamine_P1 (HMM E-Value=7.8) 28 5.4 SB_58892| Best HMM Match : IncA (HMM E-Value=1.3) 28 7.2 SB_32771| Best HMM Match : IncA (HMM E-Value=1.4) 28 7.2 SB_18936| Best HMM Match : Glyco_hydro_67N (HMM E-Value=7) 27 9.5 SB_6638| Best HMM Match : CaMBD (HMM E-Value=5.1) 27 9.5 >SB_19135| Best HMM Match : Ribosomal_L13e (HMM E-Value=0) Length = 600 Score = 207 bits (506), Expect = 5e-54 Identities = 102/192 (53%), Positives = 132/192 (68%), Gaps = 2/192 (1%) Frame = +1 Query: 52 KGNNMIPNGHFHKDWQRFVKTWFNQPARRYRRKQNRIXXXXXXXXXXXXXXLRPIVRCPT 231 K NN+IPNGHFHKDWQR+VKTWF+QP R+ RR+ R LRPIVRCPT Sbjct: 4 KRNNIIPNGHFHKDWQRYVKTWFDQPGRKKRRRVARQIKAAKIAPRPVAGSLRPIVRCPT 63 Query: 232 VRYHTKVRAGRGFTLREIRAAGLNPVFARTIGIAVDPRRRNKSVESLQINVQRIKEYRAR 411 +Y+TKVRAGRGFTL E++AAG+ A TIGIAVD RR+N+S ESLQ NVQR+KEY+++ Sbjct: 64 FKYNTKVRAGRGFTLDELKAAGIPRKVAPTIGIAVDHRRKNRSAESLQANVQRLKEYKSK 123 Query: 412 LILFP-KGKKVLKGEANEEERKLATQLRGPLMPVQQPAPKSVARPITEDEKNFKAYQYLR 588 LI+FP K K +G++ + A QL+GP+MP+ Q + ARPITEDEK + + Sbjct: 124 LIVFPRKANKPKQGDSEAADLANAVQLQGPVMPIPQESVPIKARPITEDEKKSASSRQCE 183 Query: 589 GARSI-AKLVGI 621 + + KLVG+ Sbjct: 184 SSGEVKTKLVGL 195 >SB_12085| Best HMM Match : TBP (HMM E-Value=3.5e-35) Length = 440 Score = 33.9 bits (74), Expect = 0.11 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = +1 Query: 328 IAVDPRRRNKSVESLQINVQRIKEYRARLILFPKGKKVLKGEANEEERKLATQ 486 IA+ R + + + RI+E R ++F GK V G +EE+ KLA + Sbjct: 301 IALQARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSKLAAR 353 >SB_50893| Best HMM Match : SH3_1 (HMM E-Value=2e-33) Length = 665 Score = 29.1 bits (62), Expect = 3.1 Identities = 21/74 (28%), Positives = 34/74 (45%) Frame = +1 Query: 337 DPRRRNKSVESLQINVQRIKEYRARLILFPKGKKVLKGEANEEERKLATQLRGPLMPVQQ 516 +P + ++ E+ + N ++ +E A + K KKVL E+ ++LR Sbjct: 462 EPAWKREAREAREANYKKPEEKVAPSVQHLKDKKVLPVLRPEDILSGKSELRKSWREPDV 521 Query: 517 PAPKSVARPITEDE 558 PAPK P EDE Sbjct: 522 PAPKKPVPPPPEDE 535 >SB_54753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 462 Score = 28.7 bits (61), Expect = 4.1 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = -2 Query: 177 GLSFLYSILLSAVSSSWLVKPSFNKSLPILVEMSIRYHIIPLAHFDVGVLPRQRK 13 G F +IL+ A SS L++P F+ SLP+ + + L H P +RK Sbjct: 195 GFDFGKAILVKASLSSDLIRPGFDVSLPLFPKTHPHKDLGNLPH-SCSAFPLERK 248 >SB_47063| Best HMM Match : APOBEC_C (HMM E-Value=0.41) Length = 430 Score = 28.3 bits (60), Expect = 5.4 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -3 Query: 344 RGSTAIPIVRANTGFNPAALISRRVNPLPAR--TLVWYRTVGHR 219 +GS V ++T NP L++R N +P R +L+W++ G + Sbjct: 375 KGSWVALTVESSTLANPNILLARIQNLMPGRKASLLWFKATGKK 418 >SB_16060| Best HMM Match : Protamine_P1 (HMM E-Value=7.8) Length = 91 Score = 28.3 bits (60), Expect = 5.4 Identities = 21/57 (36%), Positives = 29/57 (50%) Frame = +1 Query: 313 ARTIGIAVDPRRRNKSVESLQINVQRIKEYRARLILFPKGKKVLKGEANEEERKLAT 483 AR I +A+ RR + S+Q + EY R KG+KV KG +ERK A+ Sbjct: 17 ARRIRLAIFSRRLKFARTSVQNRQRNQAEYSER-----KGRKVRKGRKVRKERKPAS 68 >SB_58892| Best HMM Match : IncA (HMM E-Value=1.3) Length = 449 Score = 27.9 bits (59), Expect = 7.2 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = -3 Query: 344 RGSTAIPIVRANTGFNPAALISRRVNPLPAR--TLVWYRTVGHRTIGRNGP 198 +GS V +T NP L++R N +P R +L+W++ + + + P Sbjct: 176 KGSWVALTVEGSTLANPNILLARIQNLMPGRKASLLWFKATAEKGLKSDNP 226 >SB_32771| Best HMM Match : IncA (HMM E-Value=1.4) Length = 318 Score = 27.9 bits (59), Expect = 7.2 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = -3 Query: 344 RGSTAIPIVRANTGFNPAALISRRVNPLPAR--TLVWYRTVGHRTIGRNGP 198 +GS V +T NP L++R N +P R +L+W++ + + + P Sbjct: 66 KGSWVALTVEGSTLANPNILLARIQNLMPGRKASLLWFKATAEKGLKSDNP 116 >SB_18936| Best HMM Match : Glyco_hydro_67N (HMM E-Value=7) Length = 154 Score = 27.5 bits (58), Expect = 9.5 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = -3 Query: 344 RGSTAIPIVRANTGFNPAALISRRVNPLPAR--TLVWYRTVGHR 219 +GS A V +T NP L++R N +P R +L+W++ + Sbjct: 60 KGSWAALTVEGSTLANPNILLARIQNLMPGRKASLLWFKATAEK 103 >SB_6638| Best HMM Match : CaMBD (HMM E-Value=5.1) Length = 165 Score = 27.5 bits (58), Expect = 9.5 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = -3 Query: 344 RGSTAIPIVRANTGFNPAALISRRVNPLPAR--TLVWYRTVGHR 219 +GS V ++T NP L++R N +P R L+W++ G + Sbjct: 110 KGSWVALTVESSTLANPNILLARIQNLMPGRKALLLWFKATGKK 153 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,219,835 Number of Sequences: 59808 Number of extensions: 382606 Number of successful extensions: 1114 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1011 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1103 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -