BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_E04 (632 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC001409-1|AAH01409.1| 110|Homo sapiens transmembrane protein 9... 132 8e-31 >BC001409-1|AAH01409.1| 110|Homo sapiens transmembrane protein 93 protein. Length = 110 Score = 132 bits (320), Expect = 8e-31 Identities = 61/109 (55%), Positives = 81/109 (74%) Frame = +2 Query: 23 MSAVTKFKENKPEPVAYSEAALRNNAVVVEYCRTSMAALSGSTAGVLGLTGLNGFAFYVF 202 M+AV +E P SEAA+R NA V++YCRTS++ALSG+TAG+LGLTGL GF FY+ Sbjct: 1 MAAVVAKREGPP---FISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLL 57 Query: 203 AVVMLWIMFLVKVGPHWSKYFITRQSVLTNGFFGALFTYVLFWTFIYGM 349 A V+L ++ ++K G W+KYF +R+ + T G G LFTYVLFWTF+YGM Sbjct: 58 ASVLLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGM 106 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,533,639 Number of Sequences: 237096 Number of extensions: 1765895 Number of successful extensions: 7592 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 7365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7590 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6916500330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -