BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_E03 (457 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 2.7 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 2.7 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 21 4.8 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 21 4.8 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 6.3 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 22.2 bits (45), Expect = 2.7 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = +2 Query: 191 VLCIFRLLTSWLFCLHLLGPIHLLRSLIDNQKAILNAIE 307 ++C+ L+ W CL L P +L+ N +N ++ Sbjct: 282 LICMMLLIGHWSGCLQFLVP--MLQGFPSNSWVAINELQ 318 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 22.2 bits (45), Expect = 2.7 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = +2 Query: 191 VLCIFRLLTSWLFCLHLLGPIHLLRSLIDNQKAILNAIE 307 ++C+ L+ W CL L P +L+ N +N ++ Sbjct: 250 LICMMLLIGHWSGCLQFLVP--MLQGFPSNSWVAINELQ 286 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = -3 Query: 179 KYMQRQLGRCRQLGTHTPK 123 +Y Q RC+ +G H P+ Sbjct: 342 RYRQELQKRCKWMGIHEPE 360 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = -3 Query: 179 KYMQRQLGRCRQLGTHTPK 123 +Y Q RC+ +G H P+ Sbjct: 342 RYRQELQKRCKWMGIHEPE 360 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.0 bits (42), Expect = 6.3 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +1 Query: 91 RCYSCVCCRKAF 126 + Y C+ C+KAF Sbjct: 60 KTYQCLLCQKAF 71 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,200 Number of Sequences: 438 Number of extensions: 1384 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12066642 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -