BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_E02 (434 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g19630.1 68415.m02293 F-box family protein contains F-box dom... 32 0.19 At2g32800.1 68415.m04015 protein kinase family protein contains ... 29 1.8 At5g48100.1 68418.m05942 laccase family protein / diphenol oxida... 28 3.1 At5g13500.3 68418.m01559 expressed protein predicted protein At2... 27 5.5 At5g13500.2 68418.m01558 expressed protein predicted protein At2... 27 5.5 At5g13500.1 68418.m01557 expressed protein predicted protein At2... 27 5.5 At5g62470.1 68418.m07839 myb family transcription factor (MYB96)... 27 7.2 At4g31250.1 68417.m04436 leucine-rich repeat transmembrane prote... 27 7.2 At3g45130.1 68416.m04871 cycloartenol synthase, putative / 2,3-e... 27 7.2 At2g07050.1 68415.m00806 cycloartenol synthase (CAS1) / 2,3-epox... 27 7.2 At5g46330.1 68418.m05703 leucine-rich repeat transmembrane prote... 26 9.5 At1g78955.1 68414.m09205 beta-amyrin synthase, putative similar ... 26 9.5 >At2g19630.1 68415.m02293 F-box family protein contains F-box domain Pfam:PF00646 Length = 297 Score = 31.9 bits (69), Expect = 0.19 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 2/100 (2%) Frame = +2 Query: 38 LASDKLSKCLRRF*SQCWLSSPARRPTRMWCLCRTLQLPATPFP--TCHPYLYLPSTALH 211 L+ + +++C R S+ W S+ +R L R+L P F YL+L S L Sbjct: 29 LSVNSIARC--RCVSKQWASTLSRPYFTELFLTRSLARPKLLFAYRKGSDYLFLSSPQLQ 86 Query: 212 SPASTHKSHMQMIISFVNKMLK*IHTSGTSSVTINKIYCC 331 +P HK ++ VN + I T G+ +++ I CC Sbjct: 87 NPDDDHKKSSPVV---VNYHMHHILTLGSGNMSWRTIQCC 123 >At2g32800.1 68415.m04015 protein kinase family protein contains dual protein kinase domains, Pfam:PF00069 Length = 851 Score = 28.7 bits (61), Expect = 1.8 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 5/52 (9%) Frame = +2 Query: 86 CWLSSPARRPTRMWCLCR-----TLQLPATPFPTCHPYLYLPSTALHSPAST 226 C L++P RP W + + LPA P HP LY+P ++L S +++ Sbjct: 398 CSLNNPTHRPNMKWVIGALSGEFSGNLPALPSFKSHP-LYIPLSSLKSTSTS 448 >At5g48100.1 68418.m05942 laccase family protein / diphenol oxidase family protein similar to laccase [Pinus taeda][GI:13661197] Length = 565 Score = 27.9 bits (59), Expect = 3.1 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 163 LSYVSSLSVPTVYSSAFTGFYPQIAYAND 249 LSY SS T S+F+G+YP + + ND Sbjct: 300 LSYTSSCKAKT---SSFSGYYPTLPFYND 325 >At5g13500.3 68418.m01559 expressed protein predicted protein At2g25260 - Arabidopsis thaliana, EMBL:AC007070 Length = 358 Score = 27.1 bits (57), Expect = 5.5 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 121 YVVPLPYAATAGYPLSYVSSLSVPTVYSSAFTGFYP 228 +V PLP A G+P ++ P Y + +YP Sbjct: 164 FVNPLPNLAVGGFPAAFPFFYITPEKYENIVRKYYP 199 >At5g13500.2 68418.m01558 expressed protein predicted protein At2g25260 - Arabidopsis thaliana, EMBL:AC007070 Length = 358 Score = 27.1 bits (57), Expect = 5.5 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 121 YVVPLPYAATAGYPLSYVSSLSVPTVYSSAFTGFYP 228 +V PLP A G+P ++ P Y + +YP Sbjct: 164 FVNPLPNLAVGGFPAAFPFFYITPEKYENIVRKYYP 199 >At5g13500.1 68418.m01557 expressed protein predicted protein At2g25260 - Arabidopsis thaliana, EMBL:AC007070 Length = 358 Score = 27.1 bits (57), Expect = 5.5 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 121 YVVPLPYAATAGYPLSYVSSLSVPTVYSSAFTGFYP 228 +V PLP A G+P ++ P Y + +YP Sbjct: 164 FVNPLPNLAVGGFPAAFPFFYITPEKYENIVRKYYP 199 >At5g62470.1 68418.m07839 myb family transcription factor (MYB96) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 351 Score = 26.6 bits (56), Expect = 7.2 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = -3 Query: 174 HVGKGVAGSCSVRQRHHIRVGRRAGEESQHCDQKRLKHFDNL 49 H G + SC +R +++R G + G ++H ++K + H L Sbjct: 43 HTGLRCSKSCRLRWTNYLRPGIKRGNFTEH-EEKTIVHLQAL 83 >At4g31250.1 68417.m04436 leucine-rich repeat transmembrane protein kinase, putative receptor kinase, Petunia inflata, Patchx:G498278 Length = 676 Score = 26.6 bits (56), Expect = 7.2 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 108 GGRPVCGASAVRCNCRLPPFLRVILI 185 G + +CGA + C PPF V L+ Sbjct: 224 GNKGLCGAPLLPCRYTRPPFFTVFLL 249 >At3g45130.1 68416.m04871 cycloartenol synthase, putative / 2,3-epoxysqualene--cycloartenol cyclase, putative / (S)-2,3-epoxysqualene mutase, putative 77% similar to cycloartenol synthase [SP|P38605|gi:452446] [PMID: 7505443]; oxidosqualene cyclase LcOSC2 - Luffa cylindrica, EMBL:AB033335 Length = 748 Score = 26.6 bits (56), Expect = 7.2 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 113 PTRMWCLCRTLQLP 154 P RMWC CR + LP Sbjct: 251 PGRMWCHCRMVYLP 264 >At2g07050.1 68415.m00806 cycloartenol synthase (CAS1) / 2,3-epoxysqualene--cycloartenol cyclase / (S)-2,3-epoxysqualene mutase identical to cycloartenol synthase [SP:P38605 | GI:452446] [PMID:7505443] Length = 759 Score = 26.6 bits (56), Expect = 7.2 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 113 PTRMWCLCRTLQLP 154 P RMWC CR + LP Sbjct: 251 PGRMWCHCRMVYLP 264 >At5g46330.1 68418.m05703 leucine-rich repeat transmembrane protein kinase, putative Length = 1173 Score = 26.2 bits (55), Expect = 9.5 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +1 Query: 163 LSYVSSLSVPTVYSSAFTGFYPQ 231 + ++ SL V T++S+ FTG +PQ Sbjct: 332 IGFLESLEVLTLHSNNFTGEFPQ 354 >At1g78955.1 68414.m09205 beta-amyrin synthase, putative similar to beta-Amyrin Synthase GI:3688600 from [Panax ginseng] and GI:8918271 from [Pisum sativum] Length = 769 Score = 26.2 bits (55), Expect = 9.5 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 113 PTRMWCLCRTLQLP 154 P +MWC CR + +P Sbjct: 254 PAKMWCYCRLVYMP 267 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,128,722 Number of Sequences: 28952 Number of extensions: 137017 Number of successful extensions: 483 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 387 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 483 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 683042040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -