BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_D24 (483 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P67788 Cluster: Adipokinetic prohormone precursor [Cont... 95 7e-19 UniRef50_Q17128 Cluster: Hypertrehalosaemic prohormone precursor... 56 6e-07 UniRef50_Q5EY02 Cluster: Adipokinetic hormone preproprotein prec... 49 6e-05 UniRef50_A3RE77 Cluster: Adipokinetic hormone 2; n=1; Tribolium ... 49 6e-05 UniRef50_Q27Q78 Cluster: Adipokinetic hormone I preproprotein; n... 42 0.006 UniRef50_P61855 Cluster: Adipokinetic hormone precursor; n=2; So... 35 0.84 UniRef50_Q26324 Cluster: Red pigment-concentrating prohormone pr... 27 1.2 UniRef50_P19872 Cluster: Adipokinetic prohormone type 3 precurso... 34 1.9 UniRef50_A6PRU4 Cluster: Putative uncharacterized protein precur... 33 2.6 UniRef50_A3RE76 Cluster: Adipokinetic hormone 1; n=2; Tribolium ... 33 3.4 UniRef50_P55319 Cluster: Adipokinetic prohormone type 1 precurso... 33 4.5 UniRef50_A7QST6 Cluster: Chromosome chr4 scaffold_162, whole gen... 32 5.9 UniRef50_Q9AW00 Cluster: Glucose inhibited division protein A; n... 32 7.8 >UniRef50_P67788 Cluster: Adipokinetic prohormone precursor [Contains: Adipokinetic hormone (AKH)]; n=1; Manduca sexta|Rep: Adipokinetic prohormone precursor [Contains: Adipokinetic hormone (AKH)] - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) Length = 65 Score = 95.1 bits (226), Expect = 7e-19 Identities = 42/65 (64%), Positives = 54/65 (83%) Frame = +3 Query: 60 MYKFTILFLVLACFIMAEAQLTFTSSWGGKRAAIAGTVSCRNDEALASIYKLIQNEAEKL 239 MYK T+ + +A I+AEAQLTFTSSWGGKRA + ++SCRNDEA+A+IYK IQNEAE+ Sbjct: 1 MYKLTVFLMFIAFVIIAEAQLTFTSSWGGKRA-MTNSISCRNDEAIAAIYKAIQNEAERF 59 Query: 240 LLCQK 254 ++CQK Sbjct: 60 IMCQK 64 >UniRef50_Q17128 Cluster: Hypertrehalosaemic prohormone precursor [Contains: Hypertrehalosaemic hormone (HTH) (Hypertrehalosaemic neuropeptide); Hypertrehalosaemic hormone precursor-related peptide]; n=1; Blaberus discoidalis|Rep: Hypertrehalosaemic prohormone precursor [Contains: Hypertrehalosaemic hormone (HTH) (Hypertrehalosaemic neuropeptide); Hypertrehalosaemic hormone precursor-related peptide] - Blaberus discoidalis (Tropical cockroach) Length = 72 Score = 55.6 bits (128), Expect = 6e-07 Identities = 25/61 (40%), Positives = 41/61 (67%), Gaps = 1/61 (1%) Frame = +3 Query: 75 ILFLVLACFIMAEAQLTFTSSWG-GKRAAIAGTVSCRNDEALASIYKLIQNEAEKLLLCQ 251 ++ +V ++ EAQ+ F+ WG GKR+A+ + + E+L IYKL+QNEA+K+L C+ Sbjct: 8 LIVVVAIALVLCEAQVNFSPGWGTGKRSAVQDSPCKGSAESLMYIYKLVQNEAQKILECE 67 Query: 252 K 254 K Sbjct: 68 K 68 >UniRef50_Q5EY02 Cluster: Adipokinetic hormone preproprotein precursor; n=1; Periplaneta americana|Rep: Adipokinetic hormone preproprotein precursor - Periplaneta americana (American cockroach) Length = 70 Score = 48.8 bits (111), Expect = 6e-05 Identities = 24/51 (47%), Positives = 33/51 (64%) Frame = +3 Query: 102 IMAEAQLTFTSSWGGKRAAIAGTVSCRNDEALASIYKLIQNEAEKLLLCQK 254 +M EAQLTFT +WG KR+ + + E L IYKL++ EA+KL+ C K Sbjct: 17 VMCEAQLTFTPNWG-KRSGLQDGPCKLSTEVLMHIYKLVETEAQKLVECGK 66 >UniRef50_A3RE77 Cluster: Adipokinetic hormone 2; n=1; Tribolium castaneum|Rep: Adipokinetic hormone 2 - Tribolium castaneum (Red flour beetle) Length = 68 Score = 48.8 bits (111), Expect = 6e-05 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Frame = +3 Query: 60 MYKFTILFLVLACFIMAEAQLTFTSSWGGKRAAIAGTVSCRND-EALASIYKLIQNEAEK 236 M++ + L++ + AQL FT +WG KRA + C+ + + IYK+IQNEA+K Sbjct: 1 MHRVLLTVLLITIVGLCAAQLNFTPNWG-KRAPEGESNRCKESVDTIMLIYKIIQNEAQK 59 Query: 237 LLLCQK 254 L+ C+K Sbjct: 60 LVDCEK 65 >UniRef50_Q27Q78 Cluster: Adipokinetic hormone I preproprotein; n=3; Culicidae|Rep: Adipokinetic hormone I preproprotein - Anopheles gambiae (African malaria mosquito) Length = 79 Score = 42.3 bits (95), Expect = 0.006 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 10/72 (13%) Frame = +3 Query: 69 FTILFLVLACFIMAEAQLTFTSSWGGKR---------AAIAGTVSCRND-EALASIYKLI 218 FT+L + + ++ EAQLTFT +WG + + G +C+ ++L IY++I Sbjct: 7 FTVLLICASLMLITEAQLTFTPAWGKRSQGAMGINPLGSTFGQDACKTPVDSLLVIYRMI 66 Query: 219 QNEAEKLLLCQK 254 Q EA+K++ C + Sbjct: 67 QAEAQKIVDCSQ 78 >UniRef50_P61855 Cluster: Adipokinetic hormone precursor; n=2; Sophophora|Rep: Adipokinetic hormone precursor - Drosophila melanogaster (Fruit fly) Length = 79 Score = 35.1 bits (77), Expect = 0.84 Identities = 21/68 (30%), Positives = 38/68 (55%), Gaps = 9/68 (13%) Frame = +3 Query: 75 ILFLVLACFIMAEAQLTFTSSWGGKRAAIAG--------TVSCR-NDEALASIYKLIQNE 227 +LF++LAC + QLTF+ WG + AG +C+ ++E L I++ +Q++ Sbjct: 12 VLFMLLAC---VQCQLTFSPDWGKRSVGGAGPGTFFETQQGNCKTSNEMLLEIFRFVQSQ 68 Query: 228 AEKLLLCQ 251 A+ L C+ Sbjct: 69 AQLFLDCK 76 >UniRef50_Q26324 Cluster: Red pigment-concentrating prohormone precursor [Contains: Red pigment- concentrating hormone (RPCH); RPCH-related peptide]; n=2; Portunidae|Rep: Red pigment-concentrating prohormone precursor [Contains: Red pigment- concentrating hormone (RPCH); RPCH-related peptide] - Carcinus maenas (Common shore crab) (Green crab) Length = 110 Score = 27.1 bits (57), Expect(2) = 1.2 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +3 Query: 192 ALASIYKLIQNEAEKLLLCQ 251 A+ IY+LI+NEA +L+ CQ Sbjct: 85 AVMHIYRLIRNEAVRLVQCQ 104 Score = 26.6 bits (56), Expect(2) = 1.2 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +3 Query: 75 ILFLVLACFIMAEAQLTFTSSWGGKRAAIAGTVSCRNDEALASIY 209 + +V+A AQL F+ W GKRAA S EA+++++ Sbjct: 12 VALVVVALVSSVSAQLNFSPGW-GKRAAAGSGSSGGVGEAVSALH 55 >UniRef50_P19872 Cluster: Adipokinetic prohormone type 3 precursor [Contains: Adipokinetic hormone 3 (Adipokinetic hormone III) (AKH-III); Adipokinetic hormone precursor-related peptide gamma chain (APRP-gamma)]; n=1; Locusta migratoria|Rep: Adipokinetic prohormone type 3 precursor [Contains: Adipokinetic hormone 3 (Adipokinetic hormone III) (AKH-III); Adipokinetic hormone precursor-related peptide gamma chain (APRP-gamma)] - Locusta migratoria (Migratory locust) Length = 77 Score = 33.9 bits (74), Expect = 1.9 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = +3 Query: 84 LVLACFIMAEAQLTFTSSWGGKR--AAIAGTVSCRNDEALASIYKLIQNEAEKLLLCQK 254 + L + AQL FT WG + A AG + +AL SI Q E +KL+ C + Sbjct: 12 VALVAVATSRAQLNFTPWWGKRALGAPAAGDCVSASPQALLSILNAAQAEVQKLIDCSR 70 >UniRef50_A6PRU4 Cluster: Putative uncharacterized protein precursor; n=1; Victivallis vadensis ATCC BAA-548|Rep: Putative uncharacterized protein precursor - Victivallis vadensis ATCC BAA-548 Length = 264 Score = 33.5 bits (73), Expect = 2.6 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +2 Query: 26 FEVTQRTNSAKNVQIHDSIPCFGLLHNGRSPTHFH 130 F+ Q N ++ + CFGLLHNGR FH Sbjct: 199 FDSCQNDNGNYRQLVYAAFDCFGLLHNGRGSILFH 233 >UniRef50_A3RE76 Cluster: Adipokinetic hormone 1; n=2; Tribolium castaneum|Rep: Adipokinetic hormone 1 - Tribolium castaneum (Red flour beetle) Length = 73 Score = 33.1 bits (72), Expect = 3.4 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 4/52 (7%) Frame = +3 Query: 78 LFLVLACFI-MAEAQLTFTSSWGGKRAAIAGT--VSCRND-EALASIYKLIQ 221 L +VL F+ + AQL F++ WG + + AG+ +C+ E + IYK+IQ Sbjct: 6 LIVVLIAFVGVCTAQLNFSTDWGKRSGSSAGSDANNCKEPVETIMLIYKIIQ 57 >UniRef50_P55319 Cluster: Adipokinetic prohormone type 1 precursor [Contains: Adipokinetic hormone 1 (Adipokinetic hormone I) (AKH-I); Adipokinetic hormone precursor-related peptide alpha chain (APRP-alpha) (6 kDa dimeric peptide A)]; n=6; Acrididae|Rep: Adipokinetic prohormone type 1 precursor [Contains: Adipokinetic hormone 1 (Adipokinetic hormone I) (AKH-I); Adipokinetic hormone precursor-related peptide alpha chain (APRP-alpha) (6 kDa dimeric peptide A)] - Locusta migratoria (Migratory locust) Length = 63 Score = 32.7 bits (71), Expect = 4.5 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +3 Query: 75 ILFLVLACFIMAEAQLTFTSSWG-GKRAAIAGTVSCRNDEALASIYKLIQNEAEKLLLC 248 +L +V + AQL FT +WG GKR A + + +Y+LIQ EA K+ C Sbjct: 9 VLLVVAVAAALCSAQLNFTPNWGTGKRDAADFA------DPYSFLYRLIQAEARKMSGC 61 >UniRef50_A7QST6 Cluster: Chromosome chr4 scaffold_162, whole genome shotgun sequence; n=4; Vitis vinifera|Rep: Chromosome chr4 scaffold_162, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 84 Score = 32.3 bits (70), Expect = 5.9 Identities = 23/71 (32%), Positives = 28/71 (39%), Gaps = 8/71 (11%) Frame = +1 Query: 85 LFWLAS*WPKPNSLSHPAGVERGLPS--------PALCPAGTMKPWRLFINLFRMKLKNS 240 L W S KPNS P + G PS P+ P L N+ R +L Sbjct: 12 LTWYQSQGRKPNSFQFPRVINSGKPSCDRVSFQSPSPAPKAFRSVESLSENIHRRRLFRQ 71 Query: 241 CYARSLKPTPP 273 + R L PTPP Sbjct: 72 TFRRRLFPTPP 82 >UniRef50_Q9AW00 Cluster: Glucose inhibited division protein A; n=1; Guillardia theta|Rep: Glucose inhibited division protein A - Guillardia theta (Cryptomonas phi) Length = 649 Score = 31.9 bits (69), Expect = 7.8 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -2 Query: 233 FSFILNKFINRRQGFIVPAGHSAGDGSPLSTPAGCESEL 117 FS + NK IN +V GHS + + S+ +GC++ L Sbjct: 21 FSMVYNKHINSYDVIVVGGGHSGCEAAVASSKSGCKTLL 59 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 400,700,285 Number of Sequences: 1657284 Number of extensions: 8112066 Number of successful extensions: 19925 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 19286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19916 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 27710252790 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -