BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_D24 (483 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 27 2.0 SPAC1F7.05 |cdc22||ribonucleoside reductase large subunit Cdc22|... 25 6.0 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 26.6 bits (56), Expect = 2.0 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = +1 Query: 115 PNSLSHPAGVERGL----PSPALCPAGTMKPWRLFINLFRMKLKNSCYAR 252 P+S P G RG P P LC G P + F + K S +AR Sbjct: 275 PHSCGDPCGKTRGQDCEHPCPLLCHPGPCPPCTATVEKFCLCGKESIHAR 324 >SPAC1F7.05 |cdc22||ribonucleoside reductase large subunit Cdc22|Schizosaccharomyces pombe|chr 1|||Manual Length = 811 Score = 25.0 bits (52), Expect = 6.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 5 RPMISSCFEVTQRTNSAKNV 64 RP +SSCF VT + +S + + Sbjct: 212 RPQLSSCFLVTMKDDSIEGI 231 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,664,097 Number of Sequences: 5004 Number of extensions: 33849 Number of successful extensions: 73 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 186042952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -