BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_D24 (483 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92775-3|CAB62778.2| 396|Caenorhabditis elegans Hypothetical pr... 27 9.4 AB070577-1|BAC66472.1| 396|Caenorhabditis elegans L-3,4-dihydro... 27 9.4 >Z92775-3|CAB62778.2| 396|Caenorhabditis elegans Hypothetical protein C06H5.7 protein. Length = 396 Score = 26.6 bits (56), Expect = 9.4 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 39 KELTQPKMYKFTILFLVLACFIMAEAQLTFTSSW 140 + L +Y FTI+ V+ CF + +AQ F++S+ Sbjct: 202 RNLMTASVYCFTIIVFVVTCFFIRKAQ-NFSNSF 234 >AB070577-1|BAC66472.1| 396|Caenorhabditis elegans L-3,4-dihydroxyphenylalanine receptorprotein. Length = 396 Score = 26.6 bits (56), Expect = 9.4 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 39 KELTQPKMYKFTILFLVLACFIMAEAQLTFTSSW 140 + L +Y FTI+ V+ CF + +AQ F++S+ Sbjct: 202 RNLMTASVYCFTIIVFVVTCFFIRKAQ-NFSNSF 234 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,260,404 Number of Sequences: 27780 Number of extensions: 193275 Number of successful extensions: 364 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 353 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 363 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 892829112 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -