BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_D23 (654 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07741.1 68415.m00991 ATPase subunit 6, putative similar to A... 38 0.004 At2g18650.1 68415.m02173 zinc finger (C3HC4-type RING finger) fa... 28 6.2 >At2g07741.1 68415.m00991 ATPase subunit 6, putative similar to ATPase subunit 6 GI:515963 from [Raphanus sativus]; contains Pfam profile: PF00119 ATP synthase, A subunit Length = 385 Score = 38.3 bits (85), Expect = 0.004 Identities = 22/72 (30%), Positives = 30/72 (41%) Frame = +1 Query: 439 PYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIFIHIIPQGTPYILIPFIVIXETIR 618 PY FT T H G ++ H F ++P G P L PF+V+ E I Sbjct: 241 PYSFTVTSHFLITLALSFSIFIGITIVGFQRHGLHFFSFLLPAGVPLPLAPFLVLLELIS 300 Query: 619 NIIRPGTLAVRL 654 R +L +RL Sbjct: 301 YCFRALSLGIRL 312 >At2g18650.1 68415.m02173 zinc finger (C3HC4-type RING finger) family protein similar to RING-H2 finger protein RHX1a [Arabidopsis thaliana] GI:3790591; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 423 Score = 27.9 bits (59), Expect = 6.2 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +1 Query: 172 ITNLFSILDPSTNLINLPINXIRTILGLLFIPYRFXLIPNR 294 ++NL S + P+ LI + ++ I I GLL I +F L P+R Sbjct: 32 LSNLNSKITPNILLIIIILSIIFFISGLLHILVKFLLTPSR 72 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,970,892 Number of Sequences: 28952 Number of extensions: 107313 Number of successful extensions: 207 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 207 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 207 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -