BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_D22 (679 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12207| Best HMM Match : Cytochrom_B_N (HMM E-Value=2.3e-07) 78 8e-15 SB_27597| Best HMM Match : Cytochrom_B_N (HMM E-Value=0) 57 2e-08 >SB_12207| Best HMM Match : Cytochrom_B_N (HMM E-Value=2.3e-07) Length = 102 Score = 77.8 bits (183), Expect = 8e-15 Identities = 31/56 (55%), Positives = 45/56 (80%) Frame = +3 Query: 165 IYYTANIEIAFYRVNYICRNVNYG*IIRTLHANGASFFFICIYLHIGRGIYYESFN 332 ++Y A++ +AF V++I R+VNYG ++R HANGAS FFIC+Y HIGRG+YY S++ Sbjct: 1 MHYCADVSLAFASVDHIMRDVNYGFLLRYAHANGASMFFICLYAHIGRGLYYGSYS 56 >SB_27597| Best HMM Match : Cytochrom_B_N (HMM E-Value=0) Length = 135 Score = 56.8 bits (131), Expect = 2e-08 Identities = 33/110 (30%), Positives = 52/110 (47%), Gaps = 2/110 (1%) Frame = +3 Query: 225 VNYG*IIRTLHANGASFFFICIYLHIGRGIYYESFNL--KYV*LXXXXXXXXXXXXXXXX 398 VN+G +IR++H AS + + LH+ R F + + Sbjct: 4 VNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVVLAVLTASFGVTG 63 Query: 399 YVLP*GQISFWGATVITNLLSAIPYLGTILVN*I*GGFAVDNATLTRFYT 548 Y LP QI +W ++T + AIP +G+ LV + G +V +TLTRFY+ Sbjct: 64 YSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTRFYS 113 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,400,703 Number of Sequences: 59808 Number of extensions: 257846 Number of successful extensions: 427 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 426 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -