BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_D21 (370 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_46036| Best HMM Match : PSRT (HMM E-Value=1) 31 0.22 SB_39786| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.29 SB_28630| Best HMM Match : DUF1665 (HMM E-Value=3.4) 30 0.67 SB_23556| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.67 SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_43189| Best HMM Match : PGAMP (HMM E-Value=2.1) 29 1.2 SB_19124| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.1 SB_9087| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.1 SB_31178| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) 27 3.6 SB_2776| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.6 SB_31697| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_26402| Best HMM Match : K-box (HMM E-Value=1) 27 4.8 SB_59620| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_51968| Best HMM Match : PT (HMM E-Value=0.54) 27 4.8 SB_43996| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 27 4.8 SB_32907| Best HMM Match : Gly_radical (HMM E-Value=6) 27 4.8 SB_2236| Best HMM Match : PkinA_anch (HMM E-Value=3.3) 27 4.8 SB_49940| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) 27 6.3 SB_28880| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_55186| Best HMM Match : TPR_2 (HMM E-Value=0.91) 26 8.3 SB_46160| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.3 SB_41435| Best HMM Match : Cu2_monoox_C (HMM E-Value=4e-36) 26 8.3 SB_40971| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.3 SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) 26 8.3 SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.3 SB_8004| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.3 >SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 41.1 bits (92), Expect = 3e-04 Identities = 24/67 (35%), Positives = 29/67 (43%) Frame = -2 Query: 366 HPSGRCRAVSRDIRTTTEARRPGTARNTRRPKPTELSACCRERSETPRHRNKPSRPVWSR 187 H R R+ SR R +R P R +R P P S R RS +PR R+ SR R Sbjct: 219 HRRSRSRSRSRSPRRRRRSRSPRRRRRSRSPSPHHRSHRSRSRSRSPRRRHSRSRSPTHR 278 Query: 186 RSPHHFH 166 R H Sbjct: 279 RHRSRSH 285 Score = 26.2 bits (55), Expect = 8.3 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = -1 Query: 370 RSPLRAVQSREQGHQDHHRGPAPRHSEKHSASEADRAER 254 RSP R +SR + R P+P H S S + R Sbjct: 229 RSPRRRRRSRSPRRRRRSRSPSPHHRSHRSRSRSRSPRR 267 >SB_46036| Best HMM Match : PSRT (HMM E-Value=1) Length = 878 Score = 31.5 bits (68), Expect = 0.22 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = -2 Query: 363 PSGRCRAVSRDIRTTTEARRPGTARNTRRPKPTELSACCRERSETPRHRN-KPSR 202 P GR ++ SR T R+ T+ N R P P S R S +PR R+ PSR Sbjct: 534 PVGRTKSPSRSY---TSPRQRRTSPNNRSPPPRRRSPSPRRPSPSPRRRSTSPSR 585 >SB_39786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 294 Score = 31.1 bits (67), Expect = 0.29 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 4/60 (6%) Frame = -2 Query: 339 SRDIRTTTEARRPGTARNTRRPKPTELSACCR----ERSETPRHRNKPSRPVWSRRSPHH 172 +RD R T R P ++ R P+P++ R +R P + + RP +R P H Sbjct: 191 NRDTRDTINNRHPRPSQQQRHPRPSQQQRHPRPSQQQRYPRPSQQQRQPRPSQQQRYPRH 250 >SB_28630| Best HMM Match : DUF1665 (HMM E-Value=3.4) Length = 428 Score = 29.9 bits (64), Expect = 0.67 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -1 Query: 370 RSPL-RAVQSREQGHQDHHRGPAPRHSEKHSASEADRAER 254 R+PL R +SR H+DH PR S HS D ER Sbjct: 200 RTPLKRRSRSRSLRHEDHDDA-TPRRSRSHSLRHEDEEER 238 >SB_23556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 671 Score = 29.9 bits (64), Expect = 0.67 Identities = 15/59 (25%), Positives = 31/59 (52%) Frame = +3 Query: 141 SSSISKYYNGNGVDSVETKQVEKVYSGDGASLSAPGSKRSALSASDAECFSLCLGAGPL 317 ++ +S+Y ++++ + ++++Y + P S +A SD FSLC+ GPL Sbjct: 137 NTRLSEYLESRDCEAMDVR-LQRLYEHELVMYRLPESSATATPLSDLFDFSLCMCYGPL 194 >SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 29.1 bits (62), Expect = 1.2 Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = +1 Query: 181 TPSRPNR-SRRFIPVTGRL*ALPAASAQLCRLRTPSVSRCAWAPGLCGGPDVPAHGSAP 354 TPS P+ S P T + P+ + TPS APG G P P+ SAP Sbjct: 466 TPSTPSTPSTPSTPSTPSTPSTPSTPSTSSTPSTPSTPSTPSAPGTPGTPSTPSTPSAP 524 >SB_43189| Best HMM Match : PGAMP (HMM E-Value=2.1) Length = 461 Score = 29.1 bits (62), Expect = 1.2 Identities = 17/57 (29%), Positives = 22/57 (38%) Frame = -2 Query: 345 AVSRDIRTTTEARRPGTARNTRRPKPTELSACCRERSETPRHRNKPSRPVWSRRSPH 175 A+ + T RP + R R P S R +T PSRP + R PH Sbjct: 4 ALHNTLTRTRVPSRPCSLRTVRHPHTGTKSTMAYARDDTLTRTRVPSRPSRTVRHPH 60 >SB_19124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 28.3 bits (60), Expect = 2.1 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = -2 Query: 339 SRDIRTTTEARRPGTARNTRRPKPTELSACCRERSETPRHRNKPSRPVWSRRSP 178 +RD R T R P ++ R P+P++ ++R P + + RP +R P Sbjct: 151 NRDTRDTINNRHPRPSQQQRYPRPSQ-----QQRYPRPSQQQRHPRPSQQQRHP 199 >SB_9087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 28.3 bits (60), Expect = 2.1 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 286 VSRCAWAPGLCGGPDVPAHGS 348 ++R W+ LCGGPD+ GS Sbjct: 108 ITRSWWSSRLCGGPDINDDGS 128 >SB_31178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 27.9 bits (59), Expect = 2.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 322 HHRGPAPRHSEKHSASEADRAER 254 H GP+ RHS H +E++ A+R Sbjct: 123 HKEGPSSRHSNVHELNESELAKR 145 >SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) Length = 2436 Score = 27.5 bits (58), Expect = 3.6 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 367 SPLRAVQSREQGHQDHHRGPAPRHSEKHSASEA 269 +PL +Q E+ +G A R S HSA+E+ Sbjct: 1965 TPLSVIQEEEEDEVTEPQGVASRSSRTHSAAES 1997 >SB_2776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1792 Score = 27.5 bits (58), Expect = 3.6 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -1 Query: 367 SPLRAVQSREQGHQDHHRGPAPRHSEKH 284 +P++ + R +G + HHR HS+KH Sbjct: 759 APMQHLGDRREGKRRHHRRHHHSHSQKH 786 >SB_31697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 27.1 bits (57), Expect = 4.8 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = -2 Query: 315 EARRPGTARNTRRPKPTELSACCRERSETPRHRNKPSRPVWSRRSP 178 E ++P A+ T + S+ ++ + +P + PS+P WSR +P Sbjct: 432 EEKKPLEAKTTPNVG-SGASSAFQKNTPSPSPKTTPSKPSWSRPTP 476 >SB_26402| Best HMM Match : K-box (HMM E-Value=1) Length = 166 Score = 27.1 bits (57), Expect = 4.8 Identities = 15/73 (20%), Positives = 33/73 (45%) Frame = +3 Query: 99 RLSKMTMLIQQLNCSSSISKYYNGNGVDSVETKQVEKVYSGDGASLSAPGSKRSALSASD 278 +L + ++QQ++ S + VDS++ + EK + + SK+ L+++ Sbjct: 70 KLGETEYILQQMDSSVKQTAAIKEKDVDSLQQQLAEKDRRIEELNSKLESSKKDVLNSNQ 129 Query: 279 AECFSLCLGAGPL 317 +C GP+ Sbjct: 130 EKCLEKFKANGPV 142 >SB_59620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 249 Score = 27.1 bits (57), Expect = 4.8 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = -2 Query: 306 RPGTARNTRRPKPTELSACCRERSETPRHRNKPSRP 199 RP T +T ++CC P H N SRP Sbjct: 184 RPETVCHTTLTLVNRTNSCCHTTPNLPSHLNTQSRP 219 >SB_51968| Best HMM Match : PT (HMM E-Value=0.54) Length = 514 Score = 27.1 bits (57), Expect = 4.8 Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = -2 Query: 348 RAVSRDIRTTTEARRPGTARNTRR--PKPTELSACCRERSETPRHRNKPSRPV 196 R R + T+ P R P+PT+ R+R T R KP++P+ Sbjct: 257 RPTERPTKKPTKPLLPEVEPEEERATPRPTKAKPTTRKRMPTERPTKKPTKPL 309 >SB_43996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1056 Score = 27.1 bits (57), Expect = 4.8 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = -1 Query: 319 HRGPAPRHSEKHSASEADRAERLLPGALRDAPSPE 215 H P+P HS+ E LP PSPE Sbjct: 741 HSQPSPEHSQPSPEHSLPSQEHSLPSPEHSQPSPE 775 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 27.1 bits (57), Expect = 4.8 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -2 Query: 360 SGRCRAVSRDIRTTTEARRPGTARNTRRPKPTELSACCRERSETP 226 S RC+ ++ ++ ++PG+A +PK + S R+RS +P Sbjct: 1892 SRRCKTTAKALKKAKGKQKPGSATKKTKPK-QDSSKKKRKRSPSP 1935 >SB_32907| Best HMM Match : Gly_radical (HMM E-Value=6) Length = 390 Score = 27.1 bits (57), Expect = 4.8 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = -2 Query: 357 GRCRAVSRDIRTTTEARRPGTARNTRRPKPTELSACCRERSETPR 223 G+ A + + T ARRP RRP PT + R + TPR Sbjct: 11 GQNNATTTGVVPTPRARRPVPTPRARRPNPTTKA---RRPAPTPR 52 >SB_2236| Best HMM Match : PkinA_anch (HMM E-Value=3.3) Length = 331 Score = 27.1 bits (57), Expect = 4.8 Identities = 17/47 (36%), Positives = 21/47 (44%) Frame = -3 Query: 362 PPGGAEP*AGTSGPPQRPGAQAQRETLGVRSRQS*ALAAGSAQRRPV 222 P GGA G + PPQRP T+ V + A S +RPV Sbjct: 17 PRGGA---GGANAPPQRPKVHFWFSTIDVLLVEKLGYVAKSDNKRPV 60 >SB_49940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 569 Score = 26.6 bits (56), Expect = 6.3 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = -1 Query: 331 HQDHHRGPAPRHSEKHSASEADRAERLLPGALRDAPSPE*TFSTCLVSTESTPFP 167 H HH RH KH+A A R + D+P+ + T +S +S FP Sbjct: 167 HPSHHHVTKSRHQTKHNAKHATRVFSI------DSPNEDSQGKTANIS-DSASFP 214 >SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) Length = 765 Score = 26.6 bits (56), Expect = 6.3 Identities = 21/66 (31%), Positives = 29/66 (43%), Gaps = 2/66 (3%) Frame = -2 Query: 366 HPSGRCRAVSRDIRTTTEARRPGTARNT--RRPKPTELSACCRERSETPRHRNKPSRPVW 193 H R + SR R+ +R P R + R P+ S+ CR R R R+ SR Sbjct: 275 HRKHRSHSRSRSPRSK-RSRSPRKRRRSKSRSPRRYRDSSSCRRRRSRSRSRSPKSRLRS 333 Query: 192 SRRSPH 175 RSP+ Sbjct: 334 RSRSPY 339 >SB_28880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 26.6 bits (56), Expect = 6.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 Query: 286 VSRCAWAPGLCGGPDVPAH 342 V RC GL GGP+ PAH Sbjct: 45 VERCCRFEGLPGGPEDPAH 63 >SB_55186| Best HMM Match : TPR_2 (HMM E-Value=0.91) Length = 571 Score = 26.2 bits (55), Expect = 8.3 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = -3 Query: 365 TPPGGAEP*AGTSGPPQRPGAQAQRETLGVRSRQS*ALAAGSAQRRP 225 +P A P AG S PP PG A V + AA ++RP Sbjct: 517 SPKTPASPKAGLSSPPGSPGGGATSAPSNVVPPRQQQPAAAKKKQRP 563 >SB_46160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1488 Score = 26.2 bits (55), Expect = 8.3 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = -2 Query: 315 EARRPGTARNTRRPKPTELSACCRERSETP---RHR-NKPSRPVWSRRSPHHFHCS 160 EAR G+ R P + R SE P ++R PS P +S R+P CS Sbjct: 913 EARWCGSERQPETPVAPAKQSQMRFNSEAPLAPQYRYESPSEPRYSPRTPPETRCS 968 >SB_41435| Best HMM Match : Cu2_monoox_C (HMM E-Value=4e-36) Length = 821 Score = 26.2 bits (55), Expect = 8.3 Identities = 20/63 (31%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = -2 Query: 363 PSGRCRAVSRDI-RTTTEARRPGTARNTRRPKPTELSACCRERSETPRHRNKPSRPVWSR 187 P GR R R T E R PG N +RP + C T + R P R + Sbjct: 313 PPGRVTNKKRPPGRVTNEKRPPGRVTNEKRPPGKVTNQKCPPSRVTNKKR-PPGRITNEK 371 Query: 186 RSP 178 R P Sbjct: 372 RPP 374 Score = 26.2 bits (55), Expect = 8.3 Identities = 18/63 (28%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = -2 Query: 363 PSGRCRAVSRDI-RTTTEARRPGTARNTRRPKPTELSACCRERSETPRHRNKPSRPVWSR 187 P GR R R T + R PG N +RP P ++ R + P R + Sbjct: 363 PPGRITNEKRPPGRVTNQKRPPGRVTNKKRP-PGRITNQKRPPGRVTNQKRPPGRVTNKK 421 Query: 186 RSP 178 R P Sbjct: 422 RPP 424 >SB_40971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 26.2 bits (55), Expect = 8.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 Query: 335 GTSGPPQRPGAQAQRETLGVRSRQ 264 G GPP RPG Q+ T G R ++ Sbjct: 129 GPRGPPGRPGHPGQKGTRGRRGQR 152 >SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) Length = 876 Score = 26.2 bits (55), Expect = 8.3 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = -1 Query: 364 PLRAVQSREQGHQDHHRGPAPRHSEKHSASEADRAERLLPGALRDAPSP 218 P R G D H GP RH H +RL P RD P Sbjct: 134 PDRHTPPDRNGPPDRH-GPPDRHGMDHGRGRGRGRDRLSPPPHRDRGRP 181 >SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 736 Score = 26.2 bits (55), Expect = 8.3 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +1 Query: 214 IPVTGRL*ALPAASAQ--LCRLRTPSVSRCAWAP 309 IP +GR L +A+ LCR +P ++R AW P Sbjct: 534 IPTSGRCSDLDTNTAKHVLCRGLSPILTRVAWRP 567 >SB_8004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 989 Score = 26.2 bits (55), Expect = 8.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -2 Query: 369 GHPSGRCRAVSRDIRTTTEARRPGTARN 286 G+P+GR R+V+R IR T+ G N Sbjct: 602 GYPAGRPRSVARAIRKKTQQTGVGIVGN 629 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,855,778 Number of Sequences: 59808 Number of extensions: 259793 Number of successful extensions: 949 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 791 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 594991920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -