BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_D21 (370 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g12450.1 68417.m01970 expressed protein 32 0.10 At1g27060.1 68414.m03299 regulator of chromosome condensation (R... 29 0.97 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 29 1.3 At3g61940.1 68416.m06956 zinc transporter, putative similar to z... 27 3.9 At2g07630.1 68415.m00881 hypothetical protein 27 3.9 At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains... 27 3.9 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 27 5.2 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 27 5.2 At5g53440.1 68418.m06641 expressed protein 27 5.2 At2g12100.1 68415.m01300 Ulp1 protease family protein contains P... 27 5.2 At1g45090.1 68414.m05169 Ulp1 protease family protein similar to... 27 5.2 At3g43590.1 68416.m04638 zinc knuckle (CCHC-type) family protein... 26 6.8 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 26 6.8 At5g35750.1 68418.m04281 histidine kinase (AHK2) identical to hi... 26 9.0 At4g18160.1 68417.m02698 outward rectifying potassium channel, p... 26 9.0 At4g11610.1 68417.m01859 C2 domain-containing protein contains I... 26 9.0 At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, p... 26 9.0 At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p... 26 9.0 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 26 9.0 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 26 9.0 >At4g12450.1 68417.m01970 expressed protein Length = 277 Score = 32.3 bits (70), Expect = 0.10 Identities = 19/61 (31%), Positives = 28/61 (45%) Frame = -2 Query: 363 PSGRCRAVSRDIRTTTEARRPGTARNTRRPKPTELSACCRERSETPRHRNKPSRPVWSRR 184 PS CR RD+ T +PGT + +P P+ C R E + + P+R S R Sbjct: 32 PSYSCRKNVRDVVNT----QPGTVKKNPKPDPSLRRLCSSRRPELDSNSHHPTRRSVSAR 87 Query: 183 S 181 + Sbjct: 88 A 88 >At1g27060.1 68414.m03299 regulator of chromosome condensation (RCC1) family protein low similiarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 386 Score = 29.1 bits (62), Expect = 0.97 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 Query: 298 AWAPGLCGGPDVPAHGSAP 354 +W G CGGPDV A S P Sbjct: 229 SWGRGFCGGPDVHAPQSLP 247 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 28.7 bits (61), Expect = 1.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 304 APGLCGGPDVPAHGSAPPGG 363 APG G P P HG PP G Sbjct: 73 APGYGGYPPAPGHGGYPPAG 92 >At3g61940.1 68416.m06956 zinc transporter, putative similar to zinc transporter ZAT [Arabidopsis thaliana] gi|4206640|gb|AAD11757; similar to zinc transporter ZnT-2 [Rattus norvegicus] gi|1256378|gb|AAB02775; member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, PMID:11500563 Length = 334 Score = 27.1 bits (57), Expect = 3.9 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -1 Query: 334 GHQDHHRGPAPRHSEKHSASEADRAERLL 248 GH DH G HS H S +RAE+LL Sbjct: 157 GH-DHGHGHDHGHSHDHGHSYGERAEQLL 184 >At2g07630.1 68415.m00881 hypothetical protein Length = 458 Score = 27.1 bits (57), Expect = 3.9 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +3 Query: 126 QQLNCSSSISKYYNGNGVDSVETKQVEKVYSGDGASLSAPGSKRSA-LSASDAECFS 293 Q L C + +K Y + DS++ + YS + + + P SKRS+ S S A+ FS Sbjct: 369 QYLVCVENENKRYQMH--DSIDQCSLMLTYSEEPSEATTPSSKRSSDTSISPADNFS 423 >At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains ATP/GTP-binding site motif A (P-loop), PROSITE:PS00017 Length = 1340 Score = 27.1 bits (57), Expect = 3.9 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -2 Query: 315 EARRPGTARNTRRPKPTELSACCRERSETPRHRNKPSRPVWSRRSPHHFHCSI 157 E +R + R P S +ER+ P+ ++ +R RR HH SI Sbjct: 418 ERKRALEIKRDRTPTARATSKDTKERTPVPKSISRDARSSSLRRDAHHREASI 470 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 26.6 bits (56), Expect = 5.2 Identities = 18/66 (27%), Positives = 27/66 (40%), Gaps = 2/66 (3%) Frame = -2 Query: 369 GHPSGRCRAVSRDIRTTTEARRPGTARNTRRPKPTELSACCR--ERSETPRHRNKPSRPV 196 G R+ SR + + R P ++ + E+S R ERS +PR P P Sbjct: 199 GRYDNESRSHSRSLSASPARRSPRSSSPQKTSPAREVSPDKRSNERSPSPRRSLSPRSPA 258 Query: 195 WSRRSP 178 + SP Sbjct: 259 LQKASP 264 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 26.6 bits (56), Expect = 5.2 Identities = 18/66 (27%), Positives = 27/66 (40%), Gaps = 2/66 (3%) Frame = -2 Query: 369 GHPSGRCRAVSRDIRTTTEARRPGTARNTRRPKPTELSACCR--ERSETPRHRNKPSRPV 196 G R+ SR + + R P ++ + E+S R ERS +PR P P Sbjct: 199 GRYDNESRSHSRSLSASPARRSPRSSSPQKTSPAREVSPDKRSNERSPSPRRSLSPRSPA 258 Query: 195 WSRRSP 178 + SP Sbjct: 259 LQKASP 264 >At5g53440.1 68418.m06641 expressed protein Length = 1181 Score = 26.6 bits (56), Expect = 5.2 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = -1 Query: 358 RAVQSREQGHQDHHRGPAPRHSEKHSASEADRAE 257 R+++ E GH+++ R + E+H E +AE Sbjct: 550 RSIEVEETGHRNNARDYSATEEERHLVDETSQAE 583 >At2g12100.1 68415.m01300 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At5g28270, At2g05450, At1g45090, At2g16180, At2g06750 Length = 1224 Score = 26.6 bits (56), Expect = 5.2 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 316 RGPAPRHSEKHSASEADRAERLLPGALRDAPSPE 215 R P+P H +H + E+LLP + P+ E Sbjct: 681 RVPSPSHQPEHGIPDGGNFEQLLPDPILSDPALE 714 >At1g45090.1 68414.m05169 Ulp1 protease family protein similar to At5g28270, At2g12100, At2g05450, At2g16180, At2g06750; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 1210 Score = 26.6 bits (56), Expect = 5.2 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 316 RGPAPRHSEKHSASEADRAERLLPGALRDAPSPE 215 R P+P H +H + E+LLP + P+ E Sbjct: 672 RVPSPSHQPEHGIPDGGNFEQLLPDPILSDPALE 705 >At3g43590.1 68416.m04638 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 551 Score = 26.2 bits (55), Expect = 6.8 Identities = 20/66 (30%), Positives = 25/66 (37%), Gaps = 2/66 (3%) Frame = -2 Query: 357 GRCRAVSRDIRTTTEARRPGT--ARNTRRPKPTELSACCRERSETPRHRNKPSRPVWSRR 184 G+ R I + R P T N R PK S S++ RH + PS W Sbjct: 452 GKMRRPKSPITPSGYNRSPSTHIGHNYRSPKFN--SGGHYPGSQSSRHHSGPSPSRWQPS 509 Query: 183 SPHHFH 166 HH H Sbjct: 510 HQHHHH 515 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 26.2 bits (55), Expect = 6.8 Identities = 14/46 (30%), Positives = 17/46 (36%) Frame = -2 Query: 309 RRPGTARNTRRPKPTELSACCRERSETPRHRNKPSRPVWSRRSPHH 172 RR + R P+ R ETPR WSR+ HH Sbjct: 300 RREASNELNRTPRKQVQKKSALLRLETPRSYKNSRENEWSRQHNHH 345 >At5g35750.1 68418.m04281 histidine kinase (AHK2) identical to histidine kinase AHK2 [Arabidopsis thaliana] gi|13537196|dbj|BAB40774 Length = 1176 Score = 25.8 bits (54), Expect = 9.0 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +3 Query: 132 LNCSSSISKYYNGNGVDSVETKQVEKVYSGDGASLSAPG 248 + SS S+ Y G G+ +K++ ++ G+ +S PG Sbjct: 816 MQADSSTSRTYGGTGIGLSISKRLVELMQGEMGFVSEPG 854 >At4g18160.1 68417.m02698 outward rectifying potassium channel, putative (KCO6) similar to kco1 [Arabidopsis thaliana] gi|2230761|emb|CAA69158; member of the 2 pore, 4 transmembrane (2P/4TM) K+ channel family, PMID:11500563 Length = 436 Score = 25.8 bits (54), Expect = 9.0 Identities = 12/30 (40%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = +2 Query: 254 ALSSVGFGRRVFLAVPGRR-ASVVVLMSLL 340 ++++VG+G R F +PGR A++ +L+S L Sbjct: 310 SVTTVGYGDRAFKTLPGRLFAAIWLLVSTL 339 >At4g11610.1 68417.m01859 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1011 Score = 25.8 bits (54), Expect = 9.0 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = -1 Query: 355 AVQSREQGHQDHHRGPAPRHSEKHSASEADRAERLL 248 ++ + + H +HH P+H SE R +L+ Sbjct: 193 SLAAEQDNHNEHHHHYVPKHQVDEMRSEPARPSKLV 228 >At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 224 Score = 25.8 bits (54), Expect = 9.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 246 RERSETPRHRNKPSRPVWSRRSPHH 172 R RS +P +R +PS RRSP + Sbjct: 154 RRRSPSPVYRRRPSPDYTRRRSPEY 178 >At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 250 Score = 25.8 bits (54), Expect = 9.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 246 RERSETPRHRNKPSRPVWSRRSPHH 172 R RS +P +R +PS RRSP + Sbjct: 180 RRRSPSPVYRRRPSPDYTRRRSPEY 204 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 25.8 bits (54), Expect = 9.0 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 370 RSPLRAVQSREQGHQDHHRGPAPRHSEKHSAS 275 RSP ++ SR G + R P+PR S S S Sbjct: 243 RSPAKST-SRSPGPRSKSRSPSPRRSRSRSRS 273 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 25.8 bits (54), Expect = 9.0 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 370 RSPLRAVQSREQGHQDHHRGPAPRHSEKHSAS 275 RSP ++ SR G + R P+PR S S S Sbjct: 243 RSPAKST-SRSPGPRSKSRSPSPRRSRSRSRS 273 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,637,465 Number of Sequences: 28952 Number of extensions: 167926 Number of successful extensions: 625 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 608 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 487896136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -