BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_D20 (530 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 22 2.9 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 8.9 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 22.2 bits (45), Expect = 2.9 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = +2 Query: 266 VRTDKDFTAEIYRIVAPHKLTIHPNTRSGLRNHFRLYHLY 385 V TD F A I+ A +P +H+ YH Y Sbjct: 140 VYTDPAFAASIFHAAATSLPLHYPPPPPVYTHHYARYHPY 179 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 20.6 bits (41), Expect = 8.9 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +1 Query: 94 QNKAEKMGS*FTNFWLWI*IVQ 159 QNK +K NF+ W + Q Sbjct: 124 QNKGKKESKLMKNFYFWFVLKQ 145 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,382 Number of Sequences: 336 Number of extensions: 2487 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12887571 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -