BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_D19 (654 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17G6.05c |||Rhophilin-2 homolog|Schizosaccharomyces pombe|ch... 27 1.8 SPAC1002.05c |jmj2||histone demethylase Jmj2 |Schizosaccharomyce... 27 2.4 SPCC584.02 |cuf2||Cu metalloregulatory transcription factor Cuf2... 26 4.1 SPAC1B3.17 |clr2||chromatin silencing protein Clr2|Schizosacchar... 25 9.5 SPBC3B9.15c |scp1||sterol regulatory element binding protein Scp... 25 9.5 >SPAC17G6.05c |||Rhophilin-2 homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 27.5 bits (58), Expect = 1.8 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -2 Query: 338 TKMKYIMCKTHATLKIQQKKNIKSTRNLGP 249 TK+K I+ K + L+++ +N K LGP Sbjct: 467 TKLKQIIAKIKSDLEVEANENAKMKAKLGP 496 >SPAC1002.05c |jmj2||histone demethylase Jmj2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 715 Score = 27.1 bits (57), Expect = 2.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 Query: 532 HCKLFEYFNDGIVTCSVCTYCLL 600 HCK F YF+ +C T C L Sbjct: 663 HCKAFSYFSQVACSCKSITVCPL 685 >SPCC584.02 |cuf2||Cu metalloregulatory transcription factor Cuf2|Schizosaccharomyces pombe|chr 3|||Manual Length = 177 Score = 26.2 bits (55), Expect = 4.1 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -2 Query: 338 TKMKYIMCKTHATLKIQQKKNIKSTRNLGPDSPF 237 T+ + ++CK +K Q K N+K +L P PF Sbjct: 35 TRGRPLLCKKCRAIKQQLKSNLKCVCHLQPFLPF 68 >SPAC1B3.17 |clr2||chromatin silencing protein Clr2|Schizosaccharomyces pombe|chr 1|||Manual Length = 537 Score = 25.0 bits (52), Expect = 9.5 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = -1 Query: 198 NGNFIP*LLLSH*LINYKSN-----RLAYNKCVRX*NFDCKIXGN 79 N IP ++++ LINY+SN +L + V + CK GN Sbjct: 242 NNELIPAIIVARNLINYESNQMDAVKLISDTFVEPYQYHCKQLGN 286 >SPBC3B9.15c |scp1||sterol regulatory element binding protein Scp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1086 Score = 25.0 bits (52), Expect = 9.5 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +1 Query: 268 DFIFFFCCIFNVACVLHIIYFIFVIFLTIK 357 +F F C F V+ +LH +F+ V+ + I+ Sbjct: 365 EFCLFLACSFVVSFLLHGSFFLAVLSVDIR 394 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,282,405 Number of Sequences: 5004 Number of extensions: 43364 Number of successful extensions: 112 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -