BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_D18 (619 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 173 7e-44 SB_32212| Best HMM Match : Histone (HMM E-Value=9.4e-33) 126 2e-29 SB_54197| Best HMM Match : Histone (HMM E-Value=9.4e-33) 124 6e-29 SB_32396| Best HMM Match : Histone (HMM E-Value=9.4e-33) 124 6e-29 SB_31835| Best HMM Match : Histone (HMM E-Value=9.4e-33) 124 6e-29 SB_28838| Best HMM Match : Histone (HMM E-Value=9.4e-33) 124 6e-29 SB_14747| Best HMM Match : Histone (HMM E-Value=9.4e-33) 124 6e-29 SB_54382| Best HMM Match : Histone (HMM E-Value=9.4e-33) 124 6e-29 SB_45182| Best HMM Match : Histone (HMM E-Value=9.4e-33) 124 6e-29 SB_42476| Best HMM Match : Histone (HMM E-Value=9.4e-33) 124 6e-29 SB_25226| Best HMM Match : Histone (HMM E-Value=9.4e-33) 124 6e-29 SB_19336| Best HMM Match : No HMM Matches (HMM E-Value=.) 124 6e-29 SB_11028| Best HMM Match : Histone (HMM E-Value=9.4e-33) 124 6e-29 SB_9842| Best HMM Match : No HMM Matches (HMM E-Value=.) 124 6e-29 SB_8583| Best HMM Match : Histone (HMM E-Value=9.4e-33) 124 6e-29 SB_8319| Best HMM Match : Histone (HMM E-Value=9.4e-33) 124 6e-29 SB_7498| Best HMM Match : Histone (HMM E-Value=9.4e-33) 124 6e-29 SB_3888| Best HMM Match : No HMM Matches (HMM E-Value=.) 124 6e-29 SB_54557| Best HMM Match : PHK_AB (HMM E-Value=0) 123 1e-28 SB_56156| Best HMM Match : No HMM Matches (HMM E-Value=.) 122 2e-28 SB_55462| Best HMM Match : Histone (HMM E-Value=4.8e-33) 122 2e-28 SB_48204| Best HMM Match : Histone (HMM E-Value=2.7e-32) 122 2e-28 SB_46252| Best HMM Match : Histone (HMM E-Value=4.8e-33) 122 2e-28 SB_29633| Best HMM Match : Histone (HMM E-Value=5.3e-31) 122 2e-28 SB_1105| Best HMM Match : No HMM Matches (HMM E-Value=.) 122 2e-28 SB_26809| Best HMM Match : Histone (HMM E-Value=4.8e-33) 122 2e-28 SB_25701| Best HMM Match : Histone (HMM E-Value=4.8e-33) 122 2e-28 SB_54707| Best HMM Match : Histone (HMM E-Value=9.4e-33) 122 3e-28 SB_55892| Best HMM Match : Histone (HMM E-Value=9.4e-33) 121 5e-28 SB_5065| Best HMM Match : Histone (HMM E-Value=2.6e-33) 119 2e-27 SB_24673| Best HMM Match : No HMM Matches (HMM E-Value=.) 119 2e-27 SB_1956| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 4e-27 SB_57971| Best HMM Match : Histone (HMM E-Value=5.4e-33) 118 4e-27 SB_38873| Best HMM Match : Histone (HMM E-Value=2.6e-33) 118 4e-27 SB_31727| Best HMM Match : Histone (HMM E-Value=5e-33) 118 5e-27 SB_18628| Best HMM Match : Histone (HMM E-Value=1.5e-31) 115 3e-26 SB_56326| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 9e-23 SB_28189| Best HMM Match : Histone (HMM E-Value=1.5e-12) 98 4e-21 SB_31723| Best HMM Match : Histone (HMM E-Value=0.016) 86 2e-17 SB_58649| Best HMM Match : Histone (HMM E-Value=4.5e-12) 75 5e-14 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 72 4e-13 SB_44162| Best HMM Match : Histone (HMM E-Value=0.00016) 64 7e-11 SB_30055| Best HMM Match : Histone (HMM E-Value=0.97) 46 2e-05 SB_55494| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50166| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.026 SB_44025| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_30489| Best HMM Match : HEAT (HMM E-Value=9.2e-17) 30 1.7 SB_38686| Best HMM Match : 7tm_1 (HMM E-Value=5.70048e-42) 29 2.3 SB_20073| Best HMM Match : F5_F8_type_C (HMM E-Value=2.9e-18) 29 3.0 SB_16639| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_9755| Best HMM Match : Sushi (HMM E-Value=0) 28 5.3 SB_25269| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_9147| Best HMM Match : Sushi (HMM E-Value=0) 28 5.3 SB_46195| Best HMM Match : Mpv17_PMP22 (HMM E-Value=3.3) 28 7.0 SB_27184| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-05) 28 7.0 SB_23902| Best HMM Match : Pkinase (HMM E-Value=2.29813e-43) 28 7.0 SB_30088| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_22486| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_22305| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_19506| Best HMM Match : Viral_helicase1 (HMM E-Value=2.7) 28 7.0 SB_42109| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_9414| Best HMM Match : 7tm_1 (HMM E-Value=0.051) 27 9.2 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 173 bits (422), Expect = 7e-44 Identities = 86/90 (95%), Positives = 87/90 (96%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 SA AGLQFPVG IHRHLK+R TSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK Sbjct: 91 SARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 150 Query: 293 RITPRHLQLAIRGDEELDSLIKATIAGGGV 382 RITPRHLQLAIRGDEELDSLIKATIAGGGV Sbjct: 151 RITPRHLQLAIRGDEELDSLIKATIAGGGV 180 >SB_32212| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 126 bits (303), Expect = 2e-29 Identities = 66/103 (64%), Positives = 80/103 (77%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ ATIA GGV+P+I SL+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGATIAQGGVLPNIQASLLPKK 119 >SB_54197| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 124 bits (299), Expect = 6e-29 Identities = 65/103 (63%), Positives = 79/103 (76%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_32396| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 124 bits (299), Expect = 6e-29 Identities = 65/103 (63%), Positives = 79/103 (76%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_31835| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 124 bits (299), Expect = 6e-29 Identities = 65/103 (63%), Positives = 79/103 (76%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_28838| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 124 bits (299), Expect = 6e-29 Identities = 65/103 (63%), Positives = 79/103 (76%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_14747| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 124 bits (299), Expect = 6e-29 Identities = 65/103 (63%), Positives = 79/103 (76%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_54382| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 124 bits (299), Expect = 6e-29 Identities = 65/103 (63%), Positives = 79/103 (76%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_45182| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 124 bits (299), Expect = 6e-29 Identities = 65/103 (63%), Positives = 79/103 (76%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_42476| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 124 bits (299), Expect = 6e-29 Identities = 65/103 (63%), Positives = 79/103 (76%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_25226| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 124 bits (299), Expect = 6e-29 Identities = 65/103 (63%), Positives = 79/103 (76%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_19336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 124 bits (299), Expect = 6e-29 Identities = 65/103 (63%), Positives = 79/103 (76%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_11028| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 124 bits (299), Expect = 6e-29 Identities = 65/103 (63%), Positives = 79/103 (76%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_9842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 124 bits (299), Expect = 6e-29 Identities = 65/103 (63%), Positives = 79/103 (76%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_8583| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 124 bits (299), Expect = 6e-29 Identities = 65/103 (63%), Positives = 79/103 (76%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_8319| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 124 bits (299), Expect = 6e-29 Identities = 65/103 (63%), Positives = 79/103 (76%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_7498| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 124 bits (299), Expect = 6e-29 Identities = 65/103 (63%), Positives = 79/103 (76%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_3888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 986 Score = 124 bits (299), Expect = 6e-29 Identities = 61/105 (58%), Positives = 78/105 (74%), Gaps = 1/105 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 SA AGLQFPV +HR+L+ + T H R+ A A VY AA++EYLTAE+LELAGNA++D K Sbjct: 653 SAKAGLQFPVSRVHRYLR-KCTHHYRISAAAPVYQAAVMEYLTAEILELAGNAARDNKKT 711 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKKGG 424 RI PRH+ LA+ DEEL L+K TIA GGV+P+IH L+ K+ G Sbjct: 712 RIIPRHILLAVANDEELHKLLKGVTIASGGVLPNIHPELLKKRKG 756 >SB_54557| Best HMM Match : PHK_AB (HMM E-Value=0) Length = 863 Score = 123 bits (296), Expect = 1e-28 Identities = 64/103 (62%), Positives = 79/103 (76%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 755 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKT 813 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L++ TIA GGV+P+I L+ KK Sbjct: 814 RIIPRHLQLAVRNDEELNRLLRGVTIAQGGVLPNIQAVLLPKK 856 >SB_56156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 122 bits (294), Expect = 2e-28 Identities = 64/103 (62%), Positives = 78/103 (75%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_55462| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 122 bits (294), Expect = 2e-28 Identities = 64/103 (62%), Positives = 78/103 (75%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_48204| Best HMM Match : Histone (HMM E-Value=2.7e-32) Length = 125 Score = 122 bits (294), Expect = 2e-28 Identities = 65/103 (63%), Positives = 78/103 (75%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA+ D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAACDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_46252| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 134 Score = 122 bits (294), Expect = 2e-28 Identities = 64/103 (62%), Positives = 78/103 (75%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 26 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKT 84 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 85 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 127 >SB_29633| Best HMM Match : Histone (HMM E-Value=5.3e-31) Length = 125 Score = 122 bits (294), Expect = 2e-28 Identities = 64/103 (62%), Positives = 79/103 (76%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A V+ AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVHLAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_1105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 122 bits (294), Expect = 2e-28 Identities = 64/103 (62%), Positives = 78/103 (75%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 388 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKT 446 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 447 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 489 >SB_26809| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 122 bits (294), Expect = 2e-28 Identities = 64/103 (62%), Positives = 78/103 (75%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_25701| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 122 bits (294), Expect = 2e-28 Identities = 64/103 (62%), Positives = 78/103 (75%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_54707| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 126 Score = 122 bits (293), Expect = 3e-28 Identities = 64/103 (62%), Positives = 78/103 (75%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_55892| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 121 bits (291), Expect = 5e-28 Identities = 64/103 (62%), Positives = 78/103 (75%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA G V+P+I SL+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGRVLPNIQASLLPKK 119 >SB_5065| Best HMM Match : Histone (HMM E-Value=2.6e-33) Length = 330 Score = 119 bits (287), Expect = 2e-27 Identities = 63/103 (61%), Positives = 77/103 (74%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 SA AGLQFPVG +HR L+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SARAGLQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_24673| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 119 bits (287), Expect = 2e-27 Identities = 63/103 (61%), Positives = 77/103 (74%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 SA AGLQFPVG +HR L+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SARAGLQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_1956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 118 bits (284), Expect = 4e-27 Identities = 62/103 (60%), Positives = 77/103 (74%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 SA AGLQFPVG +HR L+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SARAGLQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLI-KATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 77 RIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKR 119 >SB_57971| Best HMM Match : Histone (HMM E-Value=5.4e-33) Length = 125 Score = 118 bits (284), Expect = 4e-27 Identities = 62/103 (60%), Positives = 77/103 (74%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 SA AGLQFPVG +HR L+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SAKAGLQFPVGRVHRFLR-KGNYAKRVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TI+ GGV+P+I L+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTISQGGVLPNIQAVLLPKK 119 >SB_38873| Best HMM Match : Histone (HMM E-Value=2.6e-33) Length = 125 Score = 118 bits (284), Expect = 4e-27 Identities = 62/103 (60%), Positives = 77/103 (74%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 SA AGLQFPVG +HR L+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SARAGLQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLI-KATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 77 RIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKR 119 >SB_31727| Best HMM Match : Histone (HMM E-Value=5e-33) Length = 126 Score = 118 bits (283), Expect = 5e-27 Identities = 63/103 (61%), Positives = 77/103 (74%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHR L+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_18628| Best HMM Match : Histone (HMM E-Value=1.5e-31) Length = 126 Score = 115 bits (277), Expect = 3e-26 Identities = 62/103 (60%), Positives = 76/103 (73%), Gaps = 1/103 (0%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK 292 S+ AGLQFPVG IHR L+ + RVGA VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPVGRIHRLLRKGNYAE-RVGAGDPVYMAAVLEYLSAEILELAGNAARDNKKT 76 Query: 293 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 418 RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 77 RIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_56326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 103 bits (248), Expect = 9e-23 Identities = 52/82 (63%), Positives = 63/82 (76%), Gaps = 1/82 (1%) Frame = +2 Query: 188 RVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-AT 364 RVGA A VY AA+LEYLTAE+LELAGNA++D K RI PRHLQLA+R DEEL+ L++ T Sbjct: 6 RVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKSRIVPRHLQLAVRNDEELNKLLQGVT 65 Query: 365 IAGGGVIPHIHKSLIGKKGGPG 430 IA GGV+P+I L+ KK G Sbjct: 66 IAQGGVLPNIQAVLLPKKSNTG 87 >SB_28189| Best HMM Match : Histone (HMM E-Value=1.5e-12) Length = 90 Score = 98.3 bits (234), Expect = 4e-21 Identities = 50/78 (64%), Positives = 61/78 (78%), Gaps = 1/78 (1%) Frame = +2 Query: 188 RVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-AT 364 RVGA A VY AA+LEYL+AE+LELAGNA++D K RI PRHLQLA+R DEEL+ L+ T Sbjct: 6 RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVT 65 Query: 365 IAGGGVIPHIHKSLIGKK 418 IA GGV+P+I L+ KK Sbjct: 66 IAQGGVLPNIQAVLLPKK 83 >SB_31723| Best HMM Match : Histone (HMM E-Value=0.016) Length = 76 Score = 86.2 bits (204), Expect = 2e-17 Identities = 43/68 (63%), Positives = 54/68 (79%), Gaps = 1/68 (1%) Frame = +2 Query: 218 AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHI 394 AA+LEYL+AE+LELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I Sbjct: 2 AAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNI 61 Query: 395 HKSLIGKK 418 L+ KK Sbjct: 62 QAVLLPKK 69 >SB_58649| Best HMM Match : Histone (HMM E-Value=4.5e-12) Length = 74 Score = 74.9 bits (176), Expect = 5e-14 Identities = 37/58 (63%), Positives = 46/58 (79%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK 286 S+ AGLQFP+G IHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 18 SSRAGLQFPIGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNK 74 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/53 (67%), Positives = 43/53 (81%), Gaps = 1/53 (1%) Frame = +2 Query: 227 LEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGV 382 LEYL+AE+LELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV Sbjct: 2 LEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGV 54 >SB_44162| Best HMM Match : Histone (HMM E-Value=0.00016) Length = 67 Score = 64.5 bits (150), Expect = 7e-11 Identities = 33/50 (66%), Positives = 39/50 (78%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELA 262 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+LEYL+AE+LELA Sbjct: 18 SSRAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELA 66 >SB_30055| Best HMM Match : Histone (HMM E-Value=0.97) Length = 129 Score = 46.4 bits (105), Expect = 2e-05 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAIL 229 S+ AGLQFPVG IHRHL+ + RVGA A VY AA+L Sbjct: 91 SSRAGLQFPVGRIHRHLR-KGNYAERVGAGAPVYMAAVL 128 >SB_55494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 664 Score = 38.3 bits (85), Expect = 0.005 Identities = 27/79 (34%), Positives = 39/79 (49%) Frame = +2 Query: 116 AXAGLQFPVGSIHRHLKHRXTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKR 295 A +GL FPVG I R L + RV AA+Y AA LEY+ E + A + + Sbjct: 68 ARSGLVFPVGRIFRWLLDMKVAC-RVYDAAAIYLAATLEYIAEETIYRAVTTRE--VIDH 124 Query: 296 ITPRHLQLAIRGDEELDSL 352 + P ++ + D +L SL Sbjct: 125 VVPETVEKCVNMDPDLWSL 143 >SB_50166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 35.9 bits (79), Expect = 0.026 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = +2 Query: 317 LAIRGDEELDSLIKA-TIAGGGVIPHIHKSLIGKK 418 LA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 1 LAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKR 35 >SB_44025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 35 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 113 SAXAGLQFPVGSIHRHL 163 S+ AGLQFPVG IHRHL Sbjct: 18 SSRAGLQFPVGRIHRHL 34 >SB_30489| Best HMM Match : HEAT (HMM E-Value=9.2e-17) Length = 722 Score = 29.9 bits (64), Expect = 1.7 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 6/65 (9%) Frame = -1 Query: 373 ASDSCFYEAVQFF---ISSNSKL*VPRSNTLHF*IFRRISR---QLQNLCCKIFQNSGRI 212 +SD +Y+ V +SSN L V + +F R +R Q Q LCC++ Q GR Sbjct: 241 SSDQIYYKFVPLLFRLLSSNRVLPVKLAAARTLCVFIRYNRRYEQRQELCCRLIQECGRG 300 Query: 211 NCCRS 197 RS Sbjct: 301 KSYRS 305 >SB_38686| Best HMM Match : 7tm_1 (HMM E-Value=5.70048e-42) Length = 366 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 360 QLSLAEASSHTYTNLSLERKAVLVHPFNFKL 452 Q +L S T+T ++LER ++HPF KL Sbjct: 119 QDALVSVSVFTFTAIALERYRAIIHPFKPKL 149 >SB_20073| Best HMM Match : F5_F8_type_C (HMM E-Value=2.9e-18) Length = 593 Score = 29.1 bits (62), Expect = 3.0 Identities = 19/76 (25%), Positives = 31/76 (40%), Gaps = 3/76 (3%) Frame = +2 Query: 212 YSAAILEYLTAEVLELAGNASKDLKVK---RITPRHLQLAIRGDEELDSLIKATIAGGGV 382 Y AA TA + A + L +T +H+ + R + LIK + G Sbjct: 176 YKAASTMVTTATSMVTAPTSKTSLTTTLRPALTAKHINITNRTANVVKKLIKIGLLTNGS 235 Query: 383 IPHIHKSLIGKKGGPG 430 H+H+ L G++ G Sbjct: 236 TTHVHRFLKGQRNNTG 251 >SB_16639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +3 Query: 360 QLSLAEASSHTYTNLSLERKAVLVHPFNFKL*DDKIIL 473 Q +L S +T+ ++LER +++PF KL K+++ Sbjct: 115 QDALVSVSVYTFVVIALERYRAIINPFKPKLSKSKVLI 152 >SB_9755| Best HMM Match : Sushi (HMM E-Value=0) Length = 1351 Score = 28.3 bits (60), Expect = 5.3 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -1 Query: 238 KIFQNSGRINCCRSSYAPVACXPMLKMPMNAS 143 ++ Q SGR + R+S V C P+LK PMN S Sbjct: 1203 RVCQPSGRWSGTRASCQAVDCGPLLK-PMNGS 1233 >SB_25269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 28.3 bits (60), Expect = 5.3 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 3/59 (5%) Frame = -1 Query: 517 GDDLCRCVTTAGIKCSIILSSHNLKLNGCTRTAFLSNERFVYVWDDAS---ASDSCFYE 350 G CR + T G +C ++ S K N C F + F + +A DSC E Sbjct: 632 GSITCRIIKTVGDRCLDLVPSRIFKHNSCGIALFQNTYMFFFEGSNADCFPVHDSCAKE 690 >SB_9147| Best HMM Match : Sushi (HMM E-Value=0) Length = 1656 Score = 28.3 bits (60), Expect = 5.3 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -1 Query: 238 KIFQNSGRINCCRSSYAPVACXPMLKMPMNAS 143 ++ Q SGR + R+S V C P+LK PMN S Sbjct: 873 RVCQPSGRWSGTRASCQAVDCGPLLK-PMNGS 903 >SB_46195| Best HMM Match : Mpv17_PMP22 (HMM E-Value=3.3) Length = 354 Score = 27.9 bits (59), Expect = 7.0 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 3/75 (4%) Frame = -1 Query: 532 MLTNLGDDLCRCVTTAGIKCSIILSSHNLKLNGCTRT---AFLSNERFVYVWDDASASDS 362 +L LGD R A + +L + LN C+ T AF+ N+ ++ W + S Sbjct: 231 LLWKLGDTSERKKLIATKEALALLRTSENLLNNCSNTRIDAFIDNQALLFSWHKQVSKSS 290 Query: 361 CFYEAVQFFISSNSK 317 + ++ F SS S+ Sbjct: 291 EISDIMKKFPSSYSR 305 >SB_27184| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-05) Length = 170 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +3 Query: 369 LAEASSHTYTNLSLERKAVLVHP--FNFKL*DDKI 467 L ASS T T L++ER +VHP FKL D + Sbjct: 91 LTTASSFTLTVLAVERYQAIVHPMCMRFKLRDGAV 125 >SB_23902| Best HMM Match : Pkinase (HMM E-Value=2.29813e-43) Length = 1602 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +2 Query: 338 ELDSLIKATIAGGGVIPHIHKSLIGKKGGP 427 ++ S++K TI+ + H+H +IG +G P Sbjct: 307 DMKSMLKLTISIASGLAHLHMEIIGTQGKP 336 >SB_30088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = -1 Query: 472 SIILSSHNLKLNGCTRT---AFLSNERFVYVWDDASASDSCFYEAVQFFISSNSK 317 +++ +S NL LN C+ T AF+ N+ ++ W + S + ++ F SS S+ Sbjct: 206 ALLRTSENL-LNNCSNTRIDAFIDNQALLFSWHKQVSKSSEISDIMKKFSSSYSR 259 >SB_22486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 27.9 bits (59), Expect = 7.0 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 372 AEASSHTYTNLSLERKAVLVHPFNFKL 452 A ++S T T LSL+R V++HPF +L Sbjct: 118 ATSASLTLTVLSLDRYRVIMHPFQERL 144 >SB_22305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = -1 Query: 472 SIILSSHNLKLNGCTRT---AFLSNERFVYVWDDASASDSCFYEAVQFFISSNSK 317 +++ +S NL LN C+ T AF+ N+ ++ W + S + ++ F SS S+ Sbjct: 255 ALLRTSENL-LNNCSNTRIDAFIDNQALLFSWHKQVSKSSEISDIMKKFSSSYSR 308 >SB_19506| Best HMM Match : Viral_helicase1 (HMM E-Value=2.7) Length = 828 Score = 27.9 bits (59), Expect = 7.0 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +2 Query: 251 LELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKA-TIAGGGVIPHIHKSLIGKKGGP 427 LE N +K L+ RI P H + + + KA + GG++PH++ ++I GP Sbjct: 614 LEWGRNKTKILECNRI-PGHPVANMNAENHGNHAQKADSNKAGGLLPHLYSAVIASYTGP 672 >SB_42109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 27.5 bits (58), Expect = 9.2 Identities = 18/45 (40%), Positives = 25/45 (55%) Frame = -2 Query: 348 LSNSSSPLIASCKCRGVIRFTFKSLDAFPANSKTSAVRYSKIAAE 214 LSN SP +A K R R T K++DA + K S++ K+A E Sbjct: 28 LSNDESPALAE-KERHDKRNTNKTMDATNSGDKKSSIGKLKVARE 71 >SB_9414| Best HMM Match : 7tm_1 (HMM E-Value=0.051) Length = 334 Score = 27.5 bits (58), Expect = 9.2 Identities = 12/57 (21%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = -2 Query: 390 CGMTPPPAIVAFMRLSNSSSPLIASCKC--RGVIRFTFKSLDAFPANSKTSAVRYSK 226 CG +P A+V+ RL ++ ++ C C R +++++ + N + + S+ Sbjct: 265 CGCSPLIAMVSMKRLKRATKRIVCMCLCPERAILKYSQSRRSSRKKNGAVTLLEMSR 321 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,623,249 Number of Sequences: 59808 Number of extensions: 358824 Number of successful extensions: 989 Number of sequences better than 10.0: 62 Number of HSP's better than 10.0 without gapping: 828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 911 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -