BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_D16 (477 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like pepti... 40 6e-05 AY324309-1|AAQ89694.1| 160|Anopheles gambiae insulin-like pepti... 40 6e-05 AY324310-1|AAQ89695.1| 160|Anopheles gambiae insulin-like pepti... 33 0.007 AY324315-1|AAQ89700.1| 153|Anopheles gambiae insulin-like pepti... 32 0.012 AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like pepti... 32 0.012 AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like pepti... 32 0.012 AY324308-1|AAQ89693.1| 134|Anopheles gambiae insulin-like pepti... 29 0.063 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 27 0.44 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 24 2.4 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 23 7.2 >AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like peptide 6 precursor protein. Length = 160 Score = 39.5 bits (88), Expect = 6e-05 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +3 Query: 288 GIVDECCLRPCSVDVLLSYC 347 GIV+ECCLRPC ++ LL YC Sbjct: 135 GIVEECCLRPCGMNQLLQYC 154 >AY324309-1|AAQ89694.1| 160|Anopheles gambiae insulin-like peptide 3 precursor protein. Length = 160 Score = 39.5 bits (88), Expect = 6e-05 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +3 Query: 288 GIVDECCLRPCSVDVLLSYC 347 GIV+ECCLRPC ++ LL YC Sbjct: 135 GIVEECCLRPCGMNQLLQYC 154 >AY324310-1|AAQ89695.1| 160|Anopheles gambiae insulin-like peptide 4 precursor protein. Length = 160 Score = 32.7 bits (71), Expect = 0.007 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 Query: 285 RGIVDECCLRPCSVDVLLSYC 347 R + DECC CS+ LLSYC Sbjct: 130 RDVADECCREDCSMAQLLSYC 150 >AY324315-1|AAQ89700.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 31.9 bits (69), Expect = 0.012 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 285 RGIVDECCLRPCSVDVLLSYC 347 R +V ECC + C++D L SYC Sbjct: 131 RQVVAECCYQSCTLDTLKSYC 151 Score = 29.5 bits (63), Expect = 0.063 Identities = 15/50 (30%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = +3 Query: 87 ILLAIALMLSTVMWVSTQQPQEVHTYCGRHLARTMADLCWE-EGVDKRSD 233 +LL+++ + ++ +V + ++ H YCG L+ T+A LC G K+S+ Sbjct: 24 VLLSVSGVDGSLQYVESNSQRKAH-YCGAKLSDTLAKLCNRFNGFRKKSE 72 >AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 31.9 bits (69), Expect = 0.012 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 285 RGIVDECCLRPCSVDVLLSYC 347 R +V ECC + C++D L SYC Sbjct: 131 RQVVAECCYQSCTLDTLKSYC 151 Score = 29.5 bits (63), Expect = 0.063 Identities = 15/50 (30%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = +3 Query: 87 ILLAIALMLSTVMWVSTQQPQEVHTYCGRHLARTMADLCWE-EGVDKRSD 233 +LL+++ + ++ +V + ++ H YCG L+ T+A LC G K+S+ Sbjct: 24 VLLSVSGVDGSLQYVESNSQRKAH-YCGAKLSDTLAKLCNRFNGFRKKSE 72 >AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like peptide 1 precursor protein. Length = 154 Score = 31.9 bits (69), Expect = 0.012 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 285 RGIVDECCLRPCSVDVLLSYC 347 R +V ECC + C++D L SYC Sbjct: 132 RQVVAECCYQSCTLDTLKSYC 152 Score = 29.5 bits (63), Expect = 0.063 Identities = 15/50 (30%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = +3 Query: 87 ILLAIALMLSTVMWVSTQQPQEVHTYCGRHLARTMADLCWE-EGVDKRSD 233 +LL+++ + ++ +V + ++ H YCG L+ T+A LC G K+S+ Sbjct: 24 VLLSVSGVDGSLQYVESNSQRKAH-YCGAKLSDTLAKLCNRFNGFRKKSE 72 >AY324308-1|AAQ89693.1| 134|Anopheles gambiae insulin-like peptide 2 precursor protein. Length = 134 Score = 29.5 bits (63), Expect = 0.063 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 288 GIVDECCLRPCSVDVLLSYC 347 GI DECC + CS L +YC Sbjct: 114 GIYDECCKKSCSYVELRAYC 133 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 26.6 bits (56), Expect = 0.44 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +1 Query: 277 RQDAASWMSAVSDPAAWTCFC 339 R+D SW+ V WTC C Sbjct: 296 RRDLVSWLKVVDCGIRWTCEC 316 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 24.2 bits (50), Expect = 2.4 Identities = 9/48 (18%), Positives = 22/48 (45%) Frame = +1 Query: 217 WISAAMLSSRATAPRG*CPTRQDAASWMSAVSDPAAWTCFCRTVRPLL 360 +++ + + + + P G P+ Q W+ + +W F ++ LL Sbjct: 711 YLTPQVYTEKLSVPEGLSPSDQTRRGWLIPMGGVPSWLPFLASIPALL 758 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 22.6 bits (46), Expect = 7.2 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +2 Query: 251 RLRVADALLGRTRHRG*VLSQTLQRGRASVVLL 349 +LRV LGR + QT Q R V+LL Sbjct: 4 QLRVMQVNLGRGERAQDIALQTAQEKRVDVLLL 36 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 436,482 Number of Sequences: 2352 Number of extensions: 7890 Number of successful extensions: 16 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 42095889 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -