Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P01_F_D14
         (432 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cycl...    22   3.4  
AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein ...    21   4.5  
AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.        21   7.8  
AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.        21   7.8  
AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.        21   7.8  

>AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cyclase
           alpha 1 subunit protein.
          Length = 699

 Score = 21.8 bits (44), Expect = 3.4
 Identities = 14/27 (51%), Positives = 16/27 (59%)
 Frame = -1

Query: 225 SLTRPDADTRTFHSILTTK*ASILCVL 145
           + TRP   T TFH IL  K A+ L VL
Sbjct: 334 TFTRPCGITLTFHEIL--KRANTLFVL 358


>AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein 1
           protein.
          Length = 500

 Score = 21.4 bits (43), Expect = 4.5
 Identities = 10/30 (33%), Positives = 12/30 (40%)
 Frame = +1

Query: 91  GTRYGASLRKMVKKXEVTQHAKYTCSFCGK 180
           G  +  S +  V     T    YTC  CGK
Sbjct: 210 GKGFTCSKQLKVHTRTHTGEKPYTCDICGK 239


>AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 20.6 bits (41), Expect = 7.8
 Identities = 5/9 (55%), Positives = 5/9 (55%)
 Frame = +3

Query: 66  KGWNYWQXW 92
           K WN W  W
Sbjct: 694 KSWNKWNDW 702


>AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 20.6 bits (41), Expect = 7.8
 Identities = 5/9 (55%), Positives = 5/9 (55%)
 Frame = +3

Query: 66  KGWNYWQXW 92
           K WN W  W
Sbjct: 694 KSWNKWNDW 702


>AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 20.6 bits (41), Expect = 7.8
 Identities = 5/9 (55%), Positives = 5/9 (55%)
 Frame = +3

Query: 66  KGWNYWQXW 92
           K WN W  W
Sbjct: 694 KSWNKWNDW 702


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 95,142
Number of Sequences: 438
Number of extensions: 2079
Number of successful extensions: 9
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used: 11244597
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)