BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_D11 (646 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CU457740-4|CAM36334.1| 735|Caenorhabditis elegans Hypothetical ... 33 0.13 >CU457740-4|CAM36334.1| 735|Caenorhabditis elegans Hypothetical protein C50E10.4 protein. Length = 735 Score = 33.5 bits (73), Expect = 0.13 Identities = 21/69 (30%), Positives = 28/69 (40%), Gaps = 1/69 (1%) Frame = -2 Query: 612 EAPQVQRGERAGRRVLEGQALEDGDVEGSESVRQRVGSDAAPS-KRHVEDARAAVERRHP 436 E P Q + RR E + ED D + V V +DA+ S R+ R RR Sbjct: 376 ETPAAQPRKSLPRRAAEKKKPEDSDAAEEQEVEMEVDNDASTSTPRNARGGRGGGNRRGS 435 Query: 435 RTAQRHALG 409 R Q+ G Sbjct: 436 RRGQKRTSG 444 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,443,334 Number of Sequences: 27780 Number of extensions: 150956 Number of successful extensions: 635 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 579 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 635 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1423653030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -