BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_D10 (746 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 23 2.6 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 22 4.5 EF222289-1|ABN79649.1| 68|Tribolium castaneum adipokinetic hor... 22 6.0 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = +1 Query: 394 VKFAVLVMKNPPMYFNEHIKIYLM*LHFYRTHS 492 V F +P M F H ++ HF+ +HS Sbjct: 149 VPFVTQCPIHPGMTFRYHFNVHNSGTHFWHSHS 181 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 5 RPMLHFVRCSLHL 43 RP HF RC HL Sbjct: 694 RPFSHFPRCGNHL 706 >EF222289-1|ABN79649.1| 68|Tribolium castaneum adipokinetic hormone 2 protein. Length = 68 Score = 21.8 bits (44), Expect = 6.0 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 Query: 142 KXFIDTVPLIYK*IKN 189 K +DT+ LIYK I+N Sbjct: 40 KESVDTIMLIYKIIQN 55 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,525 Number of Sequences: 336 Number of extensions: 3329 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -