BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_D06 (439 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0007 - 79867-79950,80258-80303,80409-80641,80765-80836,811... 27 8.7 08_02_0903 + 22438406-22438614,22439640-22440366,22440494-224406... 27 8.7 03_02_0602 + 9759055-9759223,9759305-9759455,9759548-9759593,975... 27 8.7 >10_01_0007 - 79867-79950,80258-80303,80409-80641,80765-80836, 81135-81230,81506-81607,81684-82349 Length = 432 Score = 26.6 bits (56), Expect = 8.7 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -3 Query: 260 LLFLTNVISCRGQRRVSDGNSSSSRGVWRYHGGY 159 LL L SC R S+ +SSSSR V R+ G+ Sbjct: 17 LLLLLVTCSCLSARERSNSSSSSSRRVVRHLPGF 50 >08_02_0903 + 22438406-22438614,22439640-22440366,22440494-22440679, 22441310-22441770,22441869-22442027,22442098-22442449, 22442563-22442842,22443330-22443661 Length = 901 Score = 26.6 bits (56), Expect = 8.7 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -2 Query: 126 CMGEIAELVPALP 88 CMG++ EL PALP Sbjct: 752 CMGDVVELTPALP 764 >03_02_0602 + 9759055-9759223,9759305-9759455,9759548-9759593, 9759974-9760033,9760519-9760555,9761268-9761347, 9761413-9761516,9761613-9761673,9762962-9763019, 9763866-9763918,9764357-9765320,9766131-9766185, 9767223-9768786 Length = 1133 Score = 26.6 bits (56), Expect = 8.7 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 47 LRSLGRVSGRSKPXGSAGTSSAIS 118 LRSL +SKP GS+ +SS+ S Sbjct: 740 LRSLASACSKSKPAGSSSSSSSAS 763 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,257,274 Number of Sequences: 37544 Number of extensions: 113917 Number of successful extensions: 371 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 371 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 823860276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -