BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_C24 (791 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 4.3 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 9.9 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 22.6 bits (46), Expect = 4.3 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -2 Query: 265 LITENSHALNKTYNTNCVHCKKKLTAQHAH-GNFHESLQRFFLLTLRIIC 119 LI N H ++T ++CV C+ +A G+F+ L + +I C Sbjct: 178 LIMGNEHTYSETGPSHCVVCQNFFYQIYATLGSFYIPLFVMIQVYYKIFC 227 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/21 (33%), Positives = 14/21 (66%) Frame = +3 Query: 81 YIYNDYLKQFSFLHIILNVSR 143 Y YN+Y K+ + + I+N+ + Sbjct: 331 YNYNNYNKKLYYKNYIINIEQ 351 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,916 Number of Sequences: 438 Number of extensions: 4340 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25003662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -