BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_C23 (604 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19131| Best HMM Match : No HMM Matches (HMM E-Value=.) 196 9e-51 SB_21597| Best HMM Match : ig (HMM E-Value=2.9e-14) 30 1.7 SB_26178| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_54838| Best HMM Match : Vitellogenin_N (HMM E-Value=4.76441e-44) 28 5.1 SB_59712| Best HMM Match : SAP (HMM E-Value=3e-13) 28 6.7 SB_49314| Best HMM Match : 7tm_1 (HMM E-Value=5.4e-30) 28 6.7 >SB_19131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 196 bits (479), Expect = 9e-51 Identities = 89/140 (63%), Positives = 107/140 (76%) Frame = +3 Query: 42 LREYEVIGRKLPSENEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVXXXX 221 L+E++VIGR +P++ PPLYKMRIF+PD +VA+S+FWYF+ QLK+ KK+ GEIV Sbjct: 207 LKEFQVIGRLMPNKKLTVPPLYKMRIFAPDDVVARSKFWYFISQLKRMKKSQGEIVSCQQ 266 Query: 222 XXXXXXXXXXNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAHSIQI 401 NFGIWLRY+SRSG HNMYREYRDL+V GAVT CYRDM ARHRAR +SIQI Sbjct: 267 IYEKKPLQIKNFGIWLRYDSRSGTHNMYREYRDLTVSGAVTACYRDMAARHRARGYSIQI 326 Query: 402 IKVEVIKAAACRRPQVKQFH 461 +KVEVI A+ RRP VKQ H Sbjct: 327 MKVEVIPASKARRPHVKQMH 346 >SB_21597| Best HMM Match : ig (HMM E-Value=2.9e-14) Length = 1931 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 493 VCTTTRDLIPSRTRGLALTSCNCNVRHITIKPM*KWK 603 +C T I SRTRGL ++CN V + + P KW+ Sbjct: 820 LCDTCAFNITSRTRGLCPSTCNKTV-SVRVDPSGKWQ 855 >SB_26178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 897 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = +3 Query: 51 YEVIGRKLP-SENEPKPPLYKMRI 119 YEV+G+ + S N+PK PL K+R+ Sbjct: 285 YEVLGKSVNNSRNQPKDPLKKLRV 308 >SB_54838| Best HMM Match : Vitellogenin_N (HMM E-Value=4.76441e-44) Length = 2581 Score = 28.3 bits (60), Expect = 5.1 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 5/61 (8%) Frame = +3 Query: 39 QLREYEVIGRKLPSENEPKPPLYKMRIFSPD-----PIVAKSRFWYFLRQLKKFKKTTGE 203 +LR Y++I ++LP+E+E K + +I +P+ VA + W L + K F +TG Sbjct: 1424 KLRLYQIISQRLPTEDENKYD-FVTKISTPNATWEREFVANASLW-LLDEEKSFSISTGA 1481 Query: 204 I 206 + Sbjct: 1482 L 1482 >SB_59712| Best HMM Match : SAP (HMM E-Value=3e-13) Length = 1072 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = +2 Query: 341 HSVLQRYGS*TQSPSSFNTDYQSGSNQGCCVSPSTGQTVPQQHHQIP 481 H + Q+ QSPS+ N + Q PQQHHQ+P Sbjct: 302 HHLPQQQPQQLQSPSNHNAQPMTTQAAAFFQQVPEQQQSPQQHHQLP 348 >SB_49314| Best HMM Match : 7tm_1 (HMM E-Value=5.4e-30) Length = 300 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +3 Query: 390 SIQIIKVEVIKAAACRRPQVKQFHNSTIRFPLPKRVHHYKRLNT 521 S++I ++ AC P V HN +R + + VHH KR+ T Sbjct: 246 SLEITCFFLLHVNACCNPVVYSLHNPKLRKCMNRLVHH-KRVRT 288 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,497,637 Number of Sequences: 59808 Number of extensions: 413215 Number of successful extensions: 1263 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1263 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -