BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_C17 (738 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51931| Best HMM Match : Ribosomal_L3 (HMM E-Value=0) 315 3e-86 SB_14332| Best HMM Match : Ribosomal_L3 (HMM E-Value=8.6e-34) 244 4e-65 SB_23052| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_59107| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_36686| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_52941| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 >SB_51931| Best HMM Match : Ribosomal_L3 (HMM E-Value=0) Length = 338 Score = 315 bits (773), Expect = 3e-86 Identities = 143/233 (61%), Positives = 170/233 (72%), Gaps = 1/233 (0%) Frame = +2 Query: 38 FQHPXHGSMGFYPKKRSRRHRGKVKAFPKDDPSKPVHLTAFIGYKAGMTHVVREPDRPGS 217 F+ P HGS+GF P+KR +RHRGKVK+FPKDD + P HLTAFIG+KAGMTH++RE ++PGS Sbjct: 5 FEAPRHGSLGFLPRKRCKRHRGKVKSFPKDDNTLPPHLTAFIGFKAGMTHILREVEKPGS 64 Query: 218 KINKKEIVEAVTIIETPPMVCVGVVGYIETPHGLRALLTVWAEHMSEDCRRRFYKNWYXX 397 K+NKKE VEAVTIIETPPM+ VGVVGYIETP G+R L T+WAEH+SE+C+RRFYKNW Sbjct: 65 KLNKKEKVEAVTIIETPPMMVVGVVGYIETPRGMRVLKTIWAEHLSEECKRRFYKNWCNS 124 Query: 398 XXXXXXXXXXXWQDELGRKSIEKDFKKMIRYCSVVRVIAHTQMKLLKQRQKKAHIMEIQL 577 W D+ G+KSIE+DF M +YC V+RVI HTQ KLLK RQKKAHIMEIQ+ Sbjct: 125 KKKAFTKASKRWADDDGKKSIEEDFNTMKKYCKVIRVICHTQQKLLKMRQKKAHIMEIQV 184 Query: 578 NGG-TIEDKVKWAXEHLEKPIPVDSVFAQDEMIDCIXXXXXXXXXXXXSRWHT 733 NGG + +KV W E LE P PV VF+ DEMID I RW T Sbjct: 185 NGGKDVAEKVDWCRERLENPAPVRKVFSPDEMIDVIGVTKGHGFKGVTYRWGT 237 >SB_14332| Best HMM Match : Ribosomal_L3 (HMM E-Value=8.6e-34) Length = 347 Score = 244 bits (598), Expect = 4e-65 Identities = 106/169 (62%), Positives = 129/169 (76%) Frame = +2 Query: 17 PACRTENFQHPXHGSMGFYPKKRSRRHRGKVKAFPKDDPSKPVHLTAFIGYKAGMTHVVR 196 P F+ P HGS+GF P+KR +RHRGKVK+FPKDD + P HLTAFIG+KAGMTH++R Sbjct: 46 PKMSHRKFEAPRHGSLGFLPRKRCKRHRGKVKSFPKDDNTLPPHLTAFIGFKAGMTHILR 105 Query: 197 EPDRPGSKINKKEIVEAVTIIETPPMVCVGVVGYIETPHGLRALLTVWAEHMSEDCRRRF 376 E ++PGSK+NKKE VEAVTIIETPPM+ VGVVGYIETP G+R L T+WAEH+SE+C+RRF Sbjct: 106 EVEKPGSKLNKKEKVEAVTIIETPPMMVVGVVGYIETPRGMRVLKTIWAEHLSEECKRRF 165 Query: 377 YKNWYXXXXXXXXXXXXXWQDELGRKSIEKDFKKMIRYCSVVRVIAHTQ 523 YKNW W D+ G+KSIE+DF M +YC V+RVI HTQ Sbjct: 166 YKNWCNSKKKAFTKASKRWADDDGKKSIEEDFNTMKKYCKVIRVICHTQ 214 Score = 28.7 bits (61), Expect = 5.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 Query: 10 LSSSMSHRKFSAPRSWVYGILSQK 81 L MSHRKF APR G L +K Sbjct: 44 LEPKMSHRKFEAPRHGSLGFLPRK 67 >SB_23052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 479 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +2 Query: 17 PACRTENFQHPXHGSMGFYPKKRSRRHRGKVKAFPKDDPSKPV 145 P C T+ QHP S+ F KK + ++G K++ K P+KPV Sbjct: 191 PVCDTDGQQHPNLCSLHFQGKKLA--YKGFCKSYCK-SPTKPV 230 >SB_59107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 89 RRHRGKVKAFPKDDPSKPVHL 151 R HR + AFP D P+ PV L Sbjct: 7 RAHRSSLHAFPPDGPAHPVSL 27 >SB_36686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 675 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 263 TPPMVCVGVVGYIETPHGLRAL-LTVWAEHMSEDCRRRFY 379 TP +C+G GY+ T L+ L LTV M E + +++ Sbjct: 301 TPGRLCIGSYGYVATQQFLQLLRLTVLPPVMIEKAKNQYH 340 >SB_52941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 772 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 89 RRHRGKVKAFPKDDPSKPVHL 151 R HR + AFP D P+ PV L Sbjct: 15 RAHRSSLHAFPPDGPAHPVSL 35 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,088,801 Number of Sequences: 59808 Number of extensions: 520656 Number of successful extensions: 1096 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1004 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1095 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1986074805 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -