BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_C15 (430 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC17G9.11c |pyr1||pyruvate carboxylase|Schizosaccharomyces pom... 25 5.0 SPBP23A10.04 |apc2||anaphase-promoting complex subunit Apc2 |Sch... 25 6.6 >SPBC17G9.11c |pyr1||pyruvate carboxylase|Schizosaccharomyces pombe|chr 2|||Manual Length = 1185 Score = 25.0 bits (52), Expect = 5.0 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = -2 Query: 273 NGHTFSVRVED*AVVTVAGLNEGADASGVSQVRVVAGPHAGVISPMGIXQG 121 +G +RV++ A V + A S + V++ PH+GV+ + + QG Sbjct: 1122 SGTIVEIRVKEGAKVKKGDII--AVLSAMKMEIVISAPHSGVLKSLAVVQG 1170 >SPBP23A10.04 |apc2||anaphase-promoting complex subunit Apc2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 681 Score = 24.6 bits (51), Expect = 6.6 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = +1 Query: 118 DALXNAHWTDDPCVRTCDDPYLTNTACVGALIQTCHCNDGLV 243 D N HW DP D T+ VG+LI + LV Sbjct: 349 DRFDNYHWMPDPIDAAPDFKKPTDRDVVGSLISIFKSKEPLV 390 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,185,332 Number of Sequences: 5004 Number of extensions: 17449 Number of successful extensions: 37 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 154448264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -