BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_C15 (430 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 vari... 28 0.051 DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 vari... 28 0.051 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 2.5 AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 21 7.7 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 21 7.7 >DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 variant 2 precursor protein. Length = 94 Score = 27.9 bits (59), Expect = 0.051 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +1 Query: 145 DDPCVRTCDDPYLTNTACVGALIQTCHCNDGLVFNADRKCVPISDC 282 D C R C + + C+ C C G + N + CVP S C Sbjct: 47 DGRCQRFCPN-VVPKPLCIKICAPGCVCRLGYLRNKKKVCVPRSKC 91 >DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 variant 1 precursor protein. Length = 92 Score = 27.9 bits (59), Expect = 0.051 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +1 Query: 145 DDPCVRTCDDPYLTNTACVGALIQTCHCNDGLVFNADRKCVPISDC 282 D C R C + + C+ C C G + N + CVP S C Sbjct: 47 DGRCQRFCPN-VVPKPLCIKICAPGCVCRLGYLRNKKKVCVPRSKC 91 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.2 bits (45), Expect = 2.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 Query: 121 ALXNAHWTDDPCVR 162 AL H+ DPCVR Sbjct: 709 ALDRLHYETDPCVR 722 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 20.6 bits (41), Expect = 7.7 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 259 KCVPISDC*NVITIYNL 309 KC+P S N IYNL Sbjct: 113 KCLPTSGSDNCNKIYNL 129 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 20.6 bits (41), Expect = 7.7 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 259 KCVPISDC*NVITIYNL 309 KC+P S N IYNL Sbjct: 113 KCLPTSGSDNCNKIYNL 129 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,114 Number of Sequences: 438 Number of extensions: 1286 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11121030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -