BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_C14 (695 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 24 4.0 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 7.0 AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 23 9.2 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 24.2 bits (50), Expect = 4.0 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = +3 Query: 474 VEEYLHLIKPNFDSLPNNQKNSLRSFLYVFSGIFGSTYLPVKSMDISMG 620 VEEY LP N+ + ++ V+SG +G P +S G Sbjct: 99 VEEYKRKWTEIVSMLPRNRDTVIGGYVNVWSGAWGMERRPNDGERVSRG 147 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.4 bits (48), Expect = 7.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +3 Query: 456 DYHLRRVEEYLHLIKPNFDSLPNNQK 533 DY+ + ++Y HL K F N K Sbjct: 968 DYYYKYYKQYPHLFKDYFSQYNKNHK 993 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 23.0 bits (47), Expect = 9.2 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +3 Query: 330 CRAWIYRRPFHWSRQS 377 C AWI+RR W +S Sbjct: 16 CLAWIHRRYHFWKDRS 31 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 773,267 Number of Sequences: 2352 Number of extensions: 16422 Number of successful extensions: 132 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 132 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -