BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_C11 (746 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 29 0.20 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 28.7 bits (61), Expect = 0.20 Identities = 27/110 (24%), Positives = 53/110 (48%), Gaps = 2/110 (1%) Frame = +1 Query: 211 YQISRGSQETCKDFYGL-QWKPQKLKMHQGNSELGPIDDERRKFLEDALKSLTVNIAEVL 387 Y+ R +E C L + K ++L QG +ER K+++ LKSL I + + Sbjct: 351 YEAMRRKEEECSRELNLKEQKRKELYAKQGRGSQFSSKEERDKWIQGELKSLNKQIKDKI 410 Query: 388 LNAIRILTNTERIRSIQFGEPLPEDVQAAFDNVLEYIDDIDTAN-DFYKM 534 + ++ + ++ + Q GE L + +Q ++ + ID N +FY++ Sbjct: 411 SHQNKLQDDLKKDIAKQ-GE-LEKKIQEHTESFEQLRVQIDEHNKNFYEL 458 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 665,339 Number of Sequences: 2352 Number of extensions: 12482 Number of successful extensions: 19 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -