BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_C05 (624 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 29 0.16 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 27 0.37 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 27 0.48 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 25 2.6 AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant r... 25 2.6 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 24 3.4 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 24 3.4 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 24 4.5 EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 23 7.9 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 23 7.9 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 28.7 bits (61), Expect = 0.16 Identities = 21/77 (27%), Positives = 31/77 (40%), Gaps = 2/77 (2%) Frame = +1 Query: 400 ELTQSIYIPKGINVPSLAREVDWEFNPL--NVKVGSHITGGDLYGIVHXNTLVKHRMLVP 573 E YIPKG + ++ ++ W P ++ SH GG I T K R Sbjct: 697 EAKNDAYIPKGGDKKIISTKLQWNAKPKIGSLDNASHKPGGGDKRIESIKTDFKERAKPK 756 Query: 574 PKAKGTVTYIXPAGNYK 624 +K +TY G+ K Sbjct: 757 IGSKDNITYKPGGGDVK 773 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 27.5 bits (58), Expect = 0.37 Identities = 9/36 (25%), Positives = 21/36 (58%) Frame = +1 Query: 364 FDGIQRPLKDINELTQSIYIPKGINVPSLAREVDWE 471 +DG Q L+ I+E+ ++ + G+++ V+W+ Sbjct: 171 YDGFQVDLRHIDEMNETNVVEVGVDLSEFYTSVEWD 206 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 27.1 bits (57), Expect = 0.48 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +1 Query: 211 NELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGKPLSVEL 339 N GEI R+ D+ ++V +E+ T GDP + SVE+ Sbjct: 547 NTQTGEI-RISRDVRFLEVDDESKEQTYGDPKIEDNPTESVEI 588 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.6 bits (51), Expect = 2.6 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = -1 Query: 462 DLPGQGRHVDTLGDVDGLSQLVDVLE---GTLNTVKDGTQDTRTKFY 331 D PG+GR V DV+ L DV E G + D + DT K Y Sbjct: 2122 DGPGEGRGVGEAEDVEVPKALGDVFESIAGAIFLDSDMSLDTVWKVY 2168 >AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant receptor Or2 protein. Length = 378 Score = 24.6 bits (51), Expect = 2.6 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = -1 Query: 570 DQHPVLDQSVXMYNTIQISTGDVGSDLNI*WVKFPVDLPGQG 445 D PVL++ + IS +G+ ++ +V +P+ +PG+G Sbjct: 104 DIRPVLERYTRRGRMLSISNLWLGAFISACFVTYPLFVPGRG 145 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -2 Query: 374 IPSKMEPKIPGPSSTDKGFPVRSTGSPTVT 285 + +K EP+ PG +T P +T PT T Sbjct: 84 VNAKCEPQSPGDQTTTTLRPATTTLRPTTT 113 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -2 Query: 374 IPSKMEPKIPGPSSTDKGFPVRSTGSPTVT 285 + +K EP+ PG +T P +T PT T Sbjct: 84 VNAKCEPQSPGDQTTTTLRPATTTLRPTTT 113 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.8 bits (49), Expect = 4.5 Identities = 11/41 (26%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +1 Query: 352 LGS-IFDGIQRPLKDINELTQSIYIPKGINVPSLAREVDWE 471 LGS +DG + L+ ++E + S + G+++ V+W+ Sbjct: 170 LGSWTYDGFKVDLRHMDEKSGSNIVDVGVDLSEFYMSVEWD 210 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 23.0 bits (47), Expect = 7.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +2 Query: 125 DMSSPYLDPSSLPKKCPDLLCTSWSVSVTMNSSVRLSVL 241 + ++P +P K CP LC S+ + S + + VL Sbjct: 123 EYTTPSWEPPGWQKVCPYPLCPSYRQFARILSIILIGVL 161 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.0 bits (47), Expect = 7.9 Identities = 8/36 (22%), Positives = 20/36 (55%) Frame = +1 Query: 364 FDGIQRPLKDINELTQSIYIPKGINVPSLAREVDWE 471 +DG + L+ ++E + S + G+++ V+W+ Sbjct: 175 YDGFKVDLRHMDEKSGSNIVDVGVDLSEFYMSVEWD 210 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 673,041 Number of Sequences: 2352 Number of extensions: 14484 Number of successful extensions: 42 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -