BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_C05 (624 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g78900.1 68414.m09198 vacuolar ATP synthase catalytic subunit... 233 9e-62 At4g38510.2 68417.m05447 vacuolar ATP synthase subunit B, putati... 52 3e-07 At4g38510.1 68417.m05446 vacuolar ATP synthase subunit B, putati... 52 3e-07 At1g76030.1 68414.m08827 vacuolar ATP synthase subunit B / V-ATP... 50 9e-07 At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putati... 50 9e-07 At1g20260.1 68414.m02529 vacuolar ATP synthase subunit B, putati... 50 9e-07 At5g08690.1 68418.m01034 ATP synthase beta chain 2, mitochondria... 40 0.002 At5g08680.1 68418.m01033 ATP synthase beta chain, mitochondrial,... 40 0.002 At5g08670.1 68418.m01032 ATP synthase beta chain 1, mitochondria... 40 0.002 At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to ... 28 0.17 At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to ... 28 0.17 At5g38340.1 68418.m04627 disease resistance protein (TIR-NBS-LRR... 30 1.4 At4g21240.1 68417.m03071 F-box family protein contains F-box dom... 30 1.4 At2g39730.3 68415.m04879 ribulose bisphosphate carboxylase/oxyge... 29 1.9 At2g39730.2 68415.m04878 ribulose bisphosphate carboxylase/oxyge... 29 1.9 At2g39730.1 68415.m04877 ribulose bisphosphate carboxylase/oxyge... 29 1.9 At1g55390.1 68414.m06335 DC1 domain-containing protein similar t... 29 3.3 At1g17970.1 68414.m02223 zinc finger (C3HC4-type RING finger) fa... 28 4.4 At3g01040.1 68416.m00005 glycosyl transferase family 8 protein c... 27 7.7 At2g41820.1 68415.m05168 leucine-rich repeat transmembrane prote... 27 7.7 >At1g78900.1 68414.m09198 vacuolar ATP synthase catalytic subunit A / V-ATPase A subunit / vacuolar proton pump alpha subunit / V-ATPase 69 kDa subunit identical to SP|O23654 Vacuolar ATP synthase catalytic subunit A (EC 3.6.3.14) (V-ATPase A subunit) (Vacuolar proton pump alpha subunit) (V-ATPase 69 kDa subunit) {Arabidopsis thaliana} Length = 623 Score = 233 bits (569), Expect = 9e-62 Identities = 110/181 (60%), Positives = 134/181 (74%) Frame = +1 Query: 79 GGLRXLANXXHXERFGYVFAVSGPVVTAEKMSGSAMYELVRVGYNELVGEIIRLEGDMAT 258 G L + +GYV VSGPVV A+ M+G+AMYELVRVG++ L+GEIIRLEGD AT Sbjct: 7 GKLTTFEDDEKESEYGYVRKVSGPVVVADGMAGAAMYELVRVGHDNLIGEIIRLEGDSAT 66 Query: 259 IQVYEETSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYIPKGIN 438 IQVYEET+G+TV DPVLRT KPLSVELGPGILG+IFDGIQRPLK I ++ +YIP+G++ Sbjct: 67 IQVYEETAGLTVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIARISGDVYIPRGVS 126 Query: 439 VPSLAREVDWEFNPLNVKVGSHITGGDLYGIVHXNTLVKHRMLVPPKAKGTVTYIXPAGN 618 VP+L ++ WEF P G ITGGDLY V NTL+ H + +PP A G +TYI PAG Sbjct: 127 VPALDKDCLWEFQPNKFVEGDTITGGDLYATVFENTLMNHLVALPPDAMGKITYIAPAGQ 186 Query: 619 Y 621 Y Sbjct: 187 Y 187 >At4g38510.2 68417.m05447 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative very strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 487 Score = 52.0 bits (119), Expect = 3e-07 Identities = 30/102 (29%), Positives = 54/102 (52%), Gaps = 4/102 (3%) Frame = +1 Query: 130 VFAVSGPVVTAEKMSGSAMYELVRVGYNELV---GEIIRLEGDMATIQVYEETSGV-TVG 297 V V+GP+V EK+ G E+V + + G+++ ++G+ A +QV+E TSG+ Sbjct: 23 VSGVAGPLVILEKVKGPKYQEIVNIRLGDGTTRRGQVLEVDGEKAVVQVFEGTSGIDNKY 82 Query: 298 DPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYI 423 V TG+ L + +LG IF+G +P+ + + Y+ Sbjct: 83 TTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEAYL 124 >At4g38510.1 68417.m05446 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative very strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 487 Score = 52.0 bits (119), Expect = 3e-07 Identities = 30/102 (29%), Positives = 54/102 (52%), Gaps = 4/102 (3%) Frame = +1 Query: 130 VFAVSGPVVTAEKMSGSAMYELVRVGYNELV---GEIIRLEGDMATIQVYEETSGV-TVG 297 V V+GP+V EK+ G E+V + + G+++ ++G+ A +QV+E TSG+ Sbjct: 23 VSGVAGPLVILEKVKGPKYQEIVNIRLGDGTTRRGQVLEVDGEKAVVQVFEGTSGIDNKY 82 Query: 298 DPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYI 423 V TG+ L + +LG IF+G +P+ + + Y+ Sbjct: 83 TTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEAYL 124 >At1g76030.1 68414.m08827 vacuolar ATP synthase subunit B / V-ATPase B subunit / vacuolar proton pump B subunit / V-ATPase 57 kDa subunit identical to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana} Length = 486 Score = 50.4 bits (115), Expect = 9e-07 Identities = 29/102 (28%), Positives = 54/102 (52%), Gaps = 4/102 (3%) Frame = +1 Query: 130 VFAVSGPVVTAEKMSGSAMYELVRVGYNE---LVGEIIRLEGDMATIQVYEETSGV-TVG 297 V V+GP+V +K+ G E+V + + G+++ ++G+ A +QV+E TSG+ Sbjct: 22 VSGVAGPLVILDKVKGPKYQEIVNIRLGDGSTRRGQVLEVDGEKAVVQVFEGTSGIDNKF 81 Query: 298 DPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYI 423 V TG+ L + +LG IF+G +P+ + + Y+ Sbjct: 82 TTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEAYL 123 >At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 485 Score = 50.4 bits (115), Expect = 9e-07 Identities = 29/102 (28%), Positives = 54/102 (52%), Gaps = 4/102 (3%) Frame = +1 Query: 130 VFAVSGPVVTAEKMSGSAMYELVRVGYNE---LVGEIIRLEGDMATIQVYEETSGV-TVG 297 V V+GP+V +K+ G E+V + + G+++ ++G+ A +QV+E TSG+ Sbjct: 22 VSGVAGPLVILDKVKGPKYQEIVNIRLGDGSTRRGQVLEVDGEKAVVQVFEGTSGIDNKF 81 Query: 298 DPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYI 423 V TG+ L + +LG IF+G +P+ + + Y+ Sbjct: 82 TTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEAYL 123 >At1g20260.1 68414.m02529 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 330 Score = 50.4 bits (115), Expect = 9e-07 Identities = 29/102 (28%), Positives = 54/102 (52%), Gaps = 4/102 (3%) Frame = +1 Query: 130 VFAVSGPVVTAEKMSGSAMYELVRVGYNE---LVGEIIRLEGDMATIQVYEETSGV-TVG 297 V V+GP+V +K+ G E+V + + G+++ ++G+ A +QV+E TSG+ Sbjct: 22 VSGVAGPLVILDKVKGPKYQEIVNIRLGDGSTRRGQVLEVDGEKAVVQVFEGTSGIDNKF 81 Query: 298 DPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYI 423 V TG+ L + +LG IF+G +P+ + + Y+ Sbjct: 82 TTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEAYL 123 >At5g08690.1 68418.m01034 ATP synthase beta chain 2, mitochondrial identical to SP|P83484 ATP synthase beta chain 2, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; strong similarity to SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain; supporting cDNA gi|26452187|dbj|AK118582.1| Length = 556 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/58 (32%), Positives = 31/58 (53%) Frame = +1 Query: 277 TSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYIPKGINVPSL 450 T G+ G VL TG P++V +G LG I + + P+ + E+ Y+P + P+L Sbjct: 141 TEGLVRGRKVLNTGAPITVPVGRATLGRIMNVLGEPIDERGEIKTEHYLPIHRDAPAL 198 >At5g08680.1 68418.m01033 ATP synthase beta chain, mitochondrial, putative strong similarity to SP|P83483 ATP synthase beta chain 1, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}, SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 559 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/58 (32%), Positives = 31/58 (53%) Frame = +1 Query: 277 TSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYIPKGINVPSL 450 T G+ G VL TG P++V +G LG I + + P+ + E+ Y+P + P+L Sbjct: 144 TEGLVRGRKVLNTGAPITVPVGRATLGRIMNVLGEPIDERGEIKTEHYLPIHRDAPAL 201 >At5g08670.1 68418.m01032 ATP synthase beta chain 1, mitochondrial identical to SP|P83483 ATP synthase beta chain 1, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; strong similarity to SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain; supporting cDNA gi|26452102|dbj|AK118538.1| Length = 556 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/58 (32%), Positives = 31/58 (53%) Frame = +1 Query: 277 TSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYIPKGINVPSL 450 T G+ G VL TG P++V +G LG I + + P+ + E+ Y+P + P+L Sbjct: 141 TEGLVRGRKVLNTGAPITVPVGRATLGRIMNVLGEPIDERGEIKTEHYLPIHRDAPAL 198 >At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 661 Score = 28.3 bits (60), Expect(2) = 0.17 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = -2 Query: 371 PSKMEPKIPGPSSTDKG-FPVRSTGSPTVTPEVSSYTWM 258 P + P P PSS FPV + SPT+ P SSY M Sbjct: 204 PLPVSPPPPLPSSHPSSLFPVTTNSSPTIPPS-SSYPQM 241 Score = 23.4 bits (48), Expect(2) = 0.17 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 146 PDTAKTYPNRSXXXXLASXLKPPLRA 69 P +A+ P RS ++ LKPP R+ Sbjct: 246 PSSAQLAPTRSKVIDVSHLLKPPHRS 271 >At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 383 Score = 28.3 bits (60), Expect(2) = 0.17 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = -2 Query: 371 PSKMEPKIPGPSSTDKG-FPVRSTGSPTVTPEVSSYTWM 258 P + P P PSS FPV + SPT+ P SSY M Sbjct: 204 PLPVSPPPPLPSSHPSSLFPVTTNSSPTIPPS-SSYPQM 241 Score = 23.4 bits (48), Expect(2) = 0.17 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 146 PDTAKTYPNRSXXXXLASXLKPPLRA 69 P +A+ P RS ++ LKPP R+ Sbjct: 246 PSSAQLAPTRSKVIDVSHLLKPPHRS 271 >At5g38340.1 68418.m04627 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1059 Score = 29.9 bits (64), Expect = 1.4 Identities = 9/34 (26%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = +1 Query: 385 LKDINELTQSIYIPKGIN-VPSLAREVDWEFNPL 483 L+ + + ++ +Y+P+G+N +P R ++W++ P+ Sbjct: 613 LRVLRDRSEKLYLPQGLNYLPKKLRLIEWDYFPM 646 >At4g21240.1 68417.m03071 F-box family protein contains F-box domain Pfam:PF00646 Length = 417 Score = 29.9 bits (64), Expect = 1.4 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 472 FNPLNVKVGSHITGGDLYGIVHXNTLVKHRMLVP-PKAKGTVTY 600 +NP + V + GD Y IV N ++ + +P PK TV Y Sbjct: 125 YNPSSESVNGLVCFGDFYNIVVWNPSMRQHVTLPEPKPHSTVRY 168 >At2g39730.3 68415.m04879 ribulose bisphosphate carboxylase/oxygenase activase / RuBisCO activase identical to SWISS-PROT:P10896 ribulose bisphosphate carboxylase/oxygenase activase, chloroplast precursor (RuBisCO activase, RA)[Arabidopsis thaliana] Length = 441 Score = 29.5 bits (63), Expect = 1.9 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = -1 Query: 243 FKTDNLTDEFIVTDTDQLVHSRSGHFFGSDDGSRYGEDIS---EPLXMXXIGER 91 F+TD + DE IVT DQ +S FFG+ Y +++ E L + IG+R Sbjct: 320 FRTDKIKDEDIVTLVDQF-PGQSIDFFGALRARVYDDEVRKFVESLGVEKIGKR 372 >At2g39730.2 68415.m04878 ribulose bisphosphate carboxylase/oxygenase activase / RuBisCO activase identical to SWISS-PROT:P10896 ribulose bisphosphate carboxylase/oxygenase activase, chloroplast precursor (RuBisCO activase, RA)[Arabidopsis thaliana] Length = 446 Score = 29.5 bits (63), Expect = 1.9 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = -1 Query: 243 FKTDNLTDEFIVTDTDQLVHSRSGHFFGSDDGSRYGEDIS---EPLXMXXIGER 91 F+TD + DE IVT DQ +S FFG+ Y +++ E L + IG+R Sbjct: 320 FRTDKIKDEDIVTLVDQF-PGQSIDFFGALRARVYDDEVRKFVESLGVEKIGKR 372 >At2g39730.1 68415.m04877 ribulose bisphosphate carboxylase/oxygenase activase / RuBisCO activase identical to SWISS-PROT:P10896 ribulose bisphosphate carboxylase/oxygenase activase, chloroplast precursor (RuBisCO activase, RA)[Arabidopsis thaliana] Length = 474 Score = 29.5 bits (63), Expect = 1.9 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = -1 Query: 243 FKTDNLTDEFIVTDTDQLVHSRSGHFFGSDDGSRYGEDIS---EPLXMXXIGER 91 F+TD + DE IVT DQ +S FFG+ Y +++ E L + IG+R Sbjct: 320 FRTDKIKDEDIVTLVDQF-PGQSIDFFGALRARVYDDEVRKFVESLGVEKIGKR 372 >At1g55390.1 68414.m06335 DC1 domain-containing protein similar to hypothetical protein GI:4204272 from [Arabidopsis thaliana] contains weak PHD zinc finger motifs contains weak PHD zinc finger motifs DC1 domain, a divergent protein kinase C domain of unknown function. Length = 684 Score = 28.7 bits (61), Expect = 3.3 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -1 Query: 261 DGGHVTFKTDNLTDEFIVTDTDQLVHSRSGHFFGSDDGSRYGED 130 DGGH + + D+ IV D D + R G G DG +D Sbjct: 124 DGGHDDEDNNFVDDDVIVNDGDGVGEDRDGDSDGDGDGGDDDDD 167 >At1g17970.1 68414.m02223 zinc finger (C3HC4-type RING finger) family protein similar to Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 368 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 409 QSIYIPKGINVPSLAREVDWEFNPLNVKVGSHI 507 +S+ P+G N+PS R++D + N N +GS + Sbjct: 163 RSVDPPRGRNIPSSRRKIDVDNNNYNHTLGSSV 195 >At3g01040.1 68416.m00005 glycosyl transferase family 8 protein contains Pfam profile: PF01501 glycosyl transferase family 8 Length = 533 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +1 Query: 337 LGPGILGSIFDGIQRPLKDINELTQSI---YIPKGINVP 444 LGP +LG I D QR ++D ++ + IP G+ +P Sbjct: 77 LGPRLLGRIDDSEQRLVRDFYKILNEVSTQEIPDGLKLP 115 >At2g41820.1 68415.m05168 leucine-rich repeat transmembrane protein kinase, putative Length = 890 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +1 Query: 196 VRVGYNELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGK 321 +R+G NELVG I R G+++ + +E G+ V K Sbjct: 259 IRIGNNELVGVIPRTIGNISGLTYFEADKNNLSGEIVAEFSK 300 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,230,870 Number of Sequences: 28952 Number of extensions: 302837 Number of successful extensions: 903 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 873 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 892 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -