BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_C04 (618 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esteras... 23 2.7 AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esteras... 23 2.7 AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esteras... 23 2.7 AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esteras... 23 2.7 AJ850287-1|CAH64507.1| 509|Tribolium castaneum putative esteras... 23 2.7 >AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = -2 Query: 266 DPTPQCESPH*LTETRQFAFTSMFASIDYHNE 171 +PT + + L ET F ++ ++ YHN+ Sbjct: 371 EPTDKNKDKFYLLETDNFFLREIWRTVKYHNK 402 >AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = -2 Query: 266 DPTPQCESPH*LTETRQFAFTSMFASIDYHNE 171 +PT + + L ET F ++ ++ YHN+ Sbjct: 371 EPTDKNKDKFYLLETDNFFLREIWRTVKYHNK 402 >AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = -2 Query: 266 DPTPQCESPH*LTETRQFAFTSMFASIDYHNE 171 +PT + + L ET F ++ ++ YHN+ Sbjct: 371 EPTDKNKDKFYLLETDNFFLREIWRTVKYHNK 402 >AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esterase protein. Length = 510 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = -2 Query: 266 DPTPQCESPH*LTETRQFAFTSMFASIDYHNE 171 +PT + + L ET F ++ ++ YHN+ Sbjct: 371 EPTDKNKDKFYLLETDNFFLREIWRTVKYHNK 402 >AJ850287-1|CAH64507.1| 509|Tribolium castaneum putative esterase protein. Length = 509 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = -2 Query: 266 DPTPQCESPH*LTETRQFAFTSMFASIDYHNE 171 +PT + + L ET F ++ ++ YHN+ Sbjct: 370 EPTDKNKDKFYLLETDNFFLREIWRTVKYHNK 401 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,460 Number of Sequences: 336 Number of extensions: 2556 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15770591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -