BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_C04 (618 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81586-11|CAF31485.1| 1165|Caenorhabditis elegans Hypothetical p... 29 2.0 Z93383-6|CAB07623.1| 283|Caenorhabditis elegans Hypothetical pr... 27 8.1 >Z81586-11|CAF31485.1| 1165|Caenorhabditis elegans Hypothetical protein T05F1.6 protein. Length = 1165 Score = 29.5 bits (63), Expect = 2.0 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +2 Query: 293 VSSVATQRCARRGGLGAAQAVK*STPENVVVWRSAPKRALSSR 421 VSS + RRGG G V + +V S P+R SSR Sbjct: 308 VSSTPSSNTPRRGGRGQKSEVNADETKTPIVSNSTPRRGRSSR 350 >Z93383-6|CAB07623.1| 283|Caenorhabditis elegans Hypothetical protein F54B8.6 protein. Length = 283 Score = 27.5 bits (58), Expect = 8.1 Identities = 9/40 (22%), Positives = 17/40 (42%) Frame = +2 Query: 479 PIAVEAMKCKEENCEVGVVLERNSLIVLSVNKTIVCLCGR 598 P+ + KC +C L + ++ S+ +C C R Sbjct: 154 PLNCDVFKCTVNSCYYNYYLTQEQIVHFSIGTMTICFCTR 193 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,035,243 Number of Sequences: 27780 Number of extensions: 253067 Number of successful extensions: 521 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 521 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1342816466 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -