Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P01_F_C03
         (407 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC016950-1|AAH16950.1|   75|Homo sapiens KLHL23 protein protein.       29   6.0  

>BC016950-1|AAH16950.1|   75|Homo sapiens KLHL23 protein protein.
          Length = 75

 Score = 29.1 bits (62), Expect = 6.0
 Identities = 14/56 (25%), Positives = 31/56 (55%), Gaps = 1/56 (1%)
 Frame = +1

Query: 142 RFLLFMYSLSIINGYSV*CIVYMLTVIIIIYINSCSFVY-YLYIFLINHCE*NEVD 306
           R  +++Y  + +  Y+  CI   + + I +YI  C ++Y Y+ I++  + + N+ D
Sbjct: 20  RAYVYIYVYTYVCMYTYMCIHTCVCIHICVYIYMCVYIYTYIRIYVYIYTQLNQWD 75


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 42,843,633
Number of Sequences: 237096
Number of extensions: 675416
Number of successful extensions: 4944
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4905
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4944
length of database: 76,859,062
effective HSP length: 82
effective length of database: 57,417,190
effective search space used: 3043111070
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)