BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_C03 (407 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC016950-1|AAH16950.1| 75|Homo sapiens KLHL23 protein protein. 29 6.0 >BC016950-1|AAH16950.1| 75|Homo sapiens KLHL23 protein protein. Length = 75 Score = 29.1 bits (62), Expect = 6.0 Identities = 14/56 (25%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +1 Query: 142 RFLLFMYSLSIINGYSV*CIVYMLTVIIIIYINSCSFVY-YLYIFLINHCE*NEVD 306 R +++Y + + Y+ CI + + I +YI C ++Y Y+ I++ + + N+ D Sbjct: 20 RAYVYIYVYTYVCMYTYMCIHTCVCIHICVYIYMCVYIYTYIRIYVYIYTQLNQWD 75 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 42,843,633 Number of Sequences: 237096 Number of extensions: 675416 Number of successful extensions: 4944 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4944 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 3043111070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -