BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_C03 (407 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U28944-9|AAL02438.1| 122|Caenorhabditis elegans Hypothetical pr... 27 6.9 AF067607-2|AAF98611.1| 109|Caenorhabditis elegans Hypothetical ... 26 9.1 >U28944-9|AAL02438.1| 122|Caenorhabditis elegans Hypothetical protein C18A3.9 protein. Length = 122 Score = 26.6 bits (56), Expect = 6.9 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 223 IIIYINSCSFVYYLYIFLINHCE*N 297 III N F+YY+++ L+N C N Sbjct: 80 IIIVNNFFVFMYYIFLVLVNVCNNN 104 >AF067607-2|AAF98611.1| 109|Caenorhabditis elegans Hypothetical protein C18H7.5 protein. Length = 109 Score = 26.2 bits (55), Expect = 9.1 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 99 NCKQNLCTPIK*FQCCFFVAHQIL*LQNIS 10 NC+ N + F+ CF +A QIL + +S Sbjct: 43 NCENNCLQNLAGFKFCFQIAQQILVIYRVS 72 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,344,091 Number of Sequences: 27780 Number of extensions: 132031 Number of successful extensions: 321 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 315 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 321 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 651753158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -