BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B22 (758 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q08967 Cluster: Flavin carrier protein 1 precursor; n=8... 36 1.4 >UniRef50_Q08967 Cluster: Flavin carrier protein 1 precursor; n=8; Saccharomycetales|Rep: Flavin carrier protein 1 precursor - Saccharomyces cerevisiae (Baker's yeast) Length = 793 Score = 35.5 bits (78), Expect = 1.4 Identities = 15/42 (35%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = +2 Query: 269 SLVRYDPFPVRYLGHVNIYLCMINLSTTFLLIFY---FNREY 385 +++RY P+ R VNI++C + L +FL +F+ FN++Y Sbjct: 503 AIIRYKPYLDRPTNIVNIFICTVTLVNSFLFMFFSNLFNQKY 544 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 667,275,902 Number of Sequences: 1657284 Number of extensions: 12301131 Number of successful extensions: 23178 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 22238 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23169 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 62969581935 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -