BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B22 (758 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 24 1.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 1.5 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 24 1.5 AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 23 2.6 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 22 6.1 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 24.2 bits (50), Expect = 1.1 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -2 Query: 640 FVHLF*TEYAAFSLHSVSLVN 578 F++LF Y +S+H S++N Sbjct: 150 FIYLFTVYYIYYSVHEASIIN 170 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.8 bits (49), Expect = 1.5 Identities = 9/39 (23%), Positives = 21/39 (53%) Frame = +1 Query: 616 TPFKINEQNLGITYFIIFKELQQIENNNPRHQNIVRRIY 732 +PF+I+ ++ + + F + + ++ RH IV +Y Sbjct: 131 SPFRIDNESQELLKYPSFARGRSLYDSRGRHSEIVETVY 169 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 558 PLYQYAHPLP*IQSPLHQ*KHSNNINPTCN 469 P Q H P + +H H+N++NPT N Sbjct: 34 PGLQGLHHSPHLNHAMHP-YHANHVNPTAN 62 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 23.0 bits (47), Expect = 2.6 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = -3 Query: 483 NPTCNT*IVHDLIYLIQYIFFVIGEFEIQINYRY 382 N CN V + IY Q FV+ F I I Y Sbjct: 219 NELCNLCQVANSIYGFQNFLFVLSTFSICITQFY 252 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 5 SAGRWFSKQSRAVGSF 52 SAG WF+ ++ A G F Sbjct: 138 SAGDWFTSRTSACGLF 153 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,211 Number of Sequences: 336 Number of extensions: 3493 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20338724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -