BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B22 (758 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1547 - 34306836-34308713,34308938-34309048,34310056-34310202 29 5.3 12_01_1022 - 10435409-10435564,10435950-10436219,10436820-104371... 28 7.0 11_06_0340 - 22500411-22500566,22500660-22500783,22500914-225010... 28 7.0 03_02_0005 + 4873802-4874036,4874156-4874227,4874728-4874815,487... 28 9.3 01_06_1699 - 39269477-39269574,39269690-39269929,39270029-392700... 28 9.3 >04_04_1547 - 34306836-34308713,34308938-34309048,34310056-34310202 Length = 711 Score = 28.7 bits (61), Expect = 5.3 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +2 Query: 479 GLMLLECFY*CRGDCIYGKGCAYWY 553 G L+ C+Y +G+C+ G CA+++ Sbjct: 112 GKQLVPCYYFKKGNCLKGDRCAFYH 136 >12_01_1022 - 10435409-10435564,10435950-10436219,10436820-10437125, 10437932-10438057,10439825-10439893,10440443-10440487, 10440717-10440776,10441527-10441589,10442186-10442266, 10442494-10442916 Length = 532 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +2 Query: 494 EC-FY*CRGDCIYGKGCAYWYRGGRQ 568 EC +Y G C +GK C Y +R G++ Sbjct: 245 ECKYYSTPGGCKFGKACKYLHRDGKE 270 >11_06_0340 - 22500411-22500566,22500660-22500783,22500914-22501080, 22501157-22501336,22501544-22502427,22502728-22502843, 22503745-22504217 Length = 699 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -2 Query: 616 YAAFSLHSVSLVNTLELPATSVPICTPFTINTVTSASIK 500 +A LH S V L+ AT P+ F INT +IK Sbjct: 189 FAMTELHHGSNVQALQTTATFDPVTDEFIINTPNDGAIK 227 >03_02_0005 + 4873802-4874036,4874156-4874227,4874728-4874815, 4875192-4875339,4875429-4875467,4875642-4875722, 4875781-4875846 Length = 242 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = -2 Query: 595 SVSLVNTLELPATSVPICTPFTI 527 ++++ TLE PAT++P+ +P TI Sbjct: 217 TIAVAVTLEAPATALPLVSPLTI 239 >01_06_1699 - 39269477-39269574,39269690-39269929,39270029-39270092, 39270251-39270771,39271032-39271326,39271400-39271564, 39271650-39272237,39272617-39272703,39272982-39274429, 39274515-39275015,39275574-39275678,39276095-39276143 Length = 1386 Score = 27.9 bits (59), Expect = 9.3 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -2 Query: 628 F*TEYAAFSLHSVSLVNTLEL-PATSVPICTPFTINTVTSASIKTFQQHQS 479 F +E SLH + L N+ + TS+P+CT + VT K QQ Q+ Sbjct: 71 FLSESLLTSLHLLHLFNSATVVDFTSLPLCTFICLVAVTMRPSKANQQDQN 121 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,772,040 Number of Sequences: 37544 Number of extensions: 297645 Number of successful extensions: 503 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 503 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2027850416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -