BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B21 (623 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05590.1 68416.m00621 60S ribosomal protein L18 (RPL18B) simi... 194 5e-50 At5g27850.1 68418.m03341 60S ribosomal protein L18 (RPL18C) 60S ... 187 5e-48 At2g47570.1 68415.m05936 60S ribosomal protein L18 (RPL18A) 153 7e-38 At1g18750.1 68414.m02338 MADS-box protein (AGL65) similar to hom... 31 0.47 At2g02640.1 68415.m00203 DC1 domain-containing protein contain... 31 0.62 At3g28360.1 68416.m03544 ABC transporter family protein similar ... 29 1.9 At2g04330.1 68415.m00429 hypothetical protein contains Pfam prof... 29 1.9 At5g35794.1 68418.m04297 hypothetical protein contains Pfam prof... 29 2.5 At4g03890.1 68417.m00546 hypothetical protein contains Pfam prof... 29 2.5 At2g23480.1 68415.m02803 hypothetical protein contains Pfam prof... 29 2.5 At3g28415.1 68416.m03551 P-glycoprotein, putative contains ATP-b... 28 4.4 At3g28390.1 68416.m03547 P-glycoprotein, putative similar to P-g... 28 4.4 At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pf... 28 4.4 At1g05440.1 68414.m00552 expressed protein ; expression supporte... 28 4.4 At3g59820.1 68416.m06675 calcium-binding mitochondrial protein-r... 28 5.8 At5g67280.1 68418.m08483 leucine-rich repeat transmembrane prote... 27 7.7 At4g35730.1 68417.m05071 expressed protein contains Pfam profil... 27 7.7 At1g32190.1 68414.m03959 expressed protein 27 7.7 >At3g05590.1 68416.m00621 60S ribosomal protein L18 (RPL18B) similar to GB:P42791 Length = 187 Score = 194 bits (472), Expect = 5e-50 Identities = 99/184 (53%), Positives = 129/184 (70%), Gaps = 3/184 (1%) Frame = +1 Query: 28 MGID-INHKHDRKVRRTEVKSQDIXXXXXXXXXXXXXXXTNAKFNQIVLRRLFMSRINRP 204 MGID I +K +RT KS D+ TN+KFN ++L+RLFMS++N+ Sbjct: 1 MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTNSKFNGVILKRLFMSKVNKA 60 Query: 205 PISVSRLARHMKKPTREGLIAVVVGTVTNDVRLYKIPKMTVAALHVTEKARARILAAGGE 384 P+S+SRL M +E IAV+VGT+T+D+R+++IP M V AL TE+ARARI AGGE Sbjct: 61 PLSLSRLVEFMTG--KEDKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGE 118 Query: 385 ILTFDQLALRAPTGKKTVLVQGQRNAREAVRHFGPAPGAPRSHTKPYVRTKGH--EKARP 558 LTFDQLALRAP G+ TVL++G +N+REAV+HFGPAPG P SH+KPYVR KG EKAR Sbjct: 119 CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRAKGRKFEKARG 178 Query: 559 SRRA 570 R++ Sbjct: 179 KRKS 182 >At5g27850.1 68418.m03341 60S ribosomal protein L18 (RPL18C) 60S ribosomal protein L18, Arabidopsis thaliana, SWISSPROT:RL18_ARATH Length = 187 Score = 187 bits (456), Expect = 5e-48 Identities = 96/184 (52%), Positives = 128/184 (69%), Gaps = 3/184 (1%) Frame = +1 Query: 28 MGID-INHKHDRKVRRTEVKSQDIXXXXXXXXXXXXXXXTNAKFNQIVLRRLFMSRINRP 204 MGID I +K +RT KS D+ +N+ FN ++L+RLFMS++N+ Sbjct: 1 MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSNSNFNAVILKRLFMSKVNKA 60 Query: 205 PISVSRLARHMKKPTREGLIAVVVGTVTNDVRLYKIPKMTVAALHVTEKARARILAAGGE 384 P+S+SRL M ++ IAV+VGT+T+D+R+++IP M V AL TE+ARARI AGGE Sbjct: 61 PLSLSRLVEFMTG--KDDKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGE 118 Query: 385 ILTFDQLALRAPTGKKTVLVQGQRNAREAVRHFGPAPGAPRSHTKPYVRTKGH--EKARP 558 LTFDQLALRAP G+ TVL++G +N+REAV+HFGPAPG P S+TKPYVR KG EKAR Sbjct: 119 CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSNTKPYVRHKGRKFEKARG 178 Query: 559 SRRA 570 R++ Sbjct: 179 KRKS 182 >At2g47570.1 68415.m05936 60S ribosomal protein L18 (RPL18A) Length = 135 Score = 153 bits (372), Expect = 7e-38 Identities = 79/132 (59%), Positives = 98/132 (74%), Gaps = 3/132 (2%) Frame = +1 Query: 184 MSRINRPPISVSRLARHMKKPTREGLIAVVVGTVTNDVRLYKIPKMTVAALHVTEKARAR 363 MS++N+ P+S+SRL R+M ++G IAV+VGTVT+DVR+ +P +TV AL TE ARAR Sbjct: 1 MSKVNKAPLSLSRLVRYMDG--KDGKIAVIVGTVTDDVRIEDVPALTVTALRFTESARAR 58 Query: 364 ILAAGGEILTFDQLALRAPT-GKKTVLVQGQRNAREAVRHFGPAPGAPRSHTKPYVRTKG 540 I AGGE LTFDQLAL PT + TVL++G +N REAV+HFGPAPG P SHTKPYVR G Sbjct: 59 IHKAGGECLTFDQLALPCPTWSENTVLLRGPKNTREAVKHFGPAPGVPHSHTKPYVRQTG 118 Query: 541 H--EKARPSRRA 570 E AR RR+ Sbjct: 119 KKIEIARGRRRS 130 >At1g18750.1 68414.m02338 MADS-box protein (AGL65) similar to homeodomain transcription factor (AGL30) GI:3461830 from [Arabidopsis thaliana]; contains Pfam domain PF00319: SRF-type transcription factor (DNA-binding and dimerisation domain); PMID: 12837945 Length = 389 Score = 31.5 bits (68), Expect = 0.47 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -2 Query: 487 GQSDALPHEHFADLVPVLSSCQSEHEEPADQ 395 G S LPH +PV SSC E +P DQ Sbjct: 223 GDSSFLPHREMDGSIPVYSSCFFESTKPEDQ 253 >At2g02640.1 68415.m00203 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 627 Score = 31.1 bits (67), Expect = 0.62 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 330 CSSCYRKSSCTHFGCWRRNSYF 395 CS+C RKS+ + C+ RN YF Sbjct: 423 CSACMRKSNGFGYSCYNRNCYF 444 >At3g28360.1 68416.m03544 ABC transporter family protein similar to P-glycoprotein homologue GI:2292907 from [Hordeum vulgare subsp. vulgare] Length = 1158 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 382 EILTFDQLALRAPTGKKTVLVQGQRNAREAV 474 E L FD L L+ P+GK LV G + + V Sbjct: 290 ETLIFDDLCLKIPSGKTVALVGGSGSGKSTV 320 >At2g04330.1 68415.m00429 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 564 Score = 29.5 bits (63), Expect = 1.9 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = -1 Query: 311 ILYSLTSFVTVPTTTAIKPSRVGFFMWRAKRDTEIGGRLIRLIKSR 174 +LY LTS + VPT T + S + F RA D I ++ R Sbjct: 347 VLYFLTSSIVVPTKTGERASPIDDFCVRAASDLTFSFEAIPSLRER 392 >At5g35794.1 68418.m04297 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 662 Score = 29.1 bits (62), Expect = 2.5 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -1 Query: 311 ILYSLTSFVTVPTTTAIKPSRVGFFMWRAKRD 216 +LY LTS + VPT T + S + F RA D Sbjct: 377 VLYFLTSIIAVPTKTGERASPIDDFCVRAASD 408 >At4g03890.1 68417.m00546 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 301 Score = 29.1 bits (62), Expect = 2.5 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = -1 Query: 314 GILYSLTSFVTVPTTTAIKPSRVGFFMWRAKRD 216 G+LY LTS + V T T K S V F RA D Sbjct: 101 GVLYFLTSIIVVLTKTGEKGSPVDNFCLRAASD 133 >At2g23480.1 68415.m02803 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 705 Score = 29.1 bits (62), Expect = 2.5 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -1 Query: 311 ILYSLTSFVTVPTTTAIKPSRVGFFMWRAKRD 216 +LY LTS + VPT T + S + F RA D Sbjct: 440 VLYFLTSIIAVPTKTGERASPIDDFCVRAASD 471 >At3g28415.1 68416.m03551 P-glycoprotein, putative contains ATP-binding cassette; related to multi drug resistance proteins Length = 1221 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 394 FDQLALRAPTGKKTVLVQGQRNAREAV 474 FD L LR P+GK LV G + + V Sbjct: 356 FDDLCLRIPSGKSVALVGGSGSGKSTV 382 >At3g28390.1 68416.m03547 P-glycoprotein, putative similar to P-glycoprotein homologue GI:2292907 from [Hordeum vulgare subsp. vulgare] Length = 1225 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 394 FDQLALRAPTGKKTVLVQGQRNAREAV 474 FD L LR P+GK LV G + + V Sbjct: 365 FDDLCLRVPSGKTVALVGGSGSGKSTV 391 >At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 883 Score = 28.3 bits (60), Expect = 4.4 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +3 Query: 294 RETVQDTEDDGGCSSCY--RKSSCTHFGCWRRNSYF*SAGSSCS 419 R+ + +E GGC+SC KS T C R+ + S G+ CS Sbjct: 145 RDHGECSESVGGCASCIVRSKSDITTSQCGDRDRRYTSPGNPCS 188 >At1g05440.1 68414.m00552 expressed protein ; expression supported by MPSS Length = 393 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = -3 Query: 471 CLTSISLTLYQYCLLASRSTKSQLIKSKNFSSSSQNACTSF 349 CL S++ TL L +S+ ++L + NF S+ ++ TSF Sbjct: 71 CLDSLNATLDLMPLSVQKSSLTKLSSASNFKSTVESTPTSF 111 >At3g59820.1 68416.m06675 calcium-binding mitochondrial protein-related contains weak similarity to Calcium-binding mitochondrial protein Anon-60Da (Swiss-Prot:P91927) [Drosophila melanogaster] Length = 755 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 157 NQIVLRRLFMSRINRPPISVSRLARHMKKPTREGLI 264 +Q V + S INRPP+ + H R+GL+ Sbjct: 34 SQTVHSHAYHSGINRPPVETKPVTEHKSFTRRDGLL 69 >At5g67280.1 68418.m08483 leucine-rich repeat transmembrane protein kinase, putative Length = 751 Score = 27.5 bits (58), Expect = 7.7 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = -2 Query: 382 LLQQPKCVHELFR*HEEQPPS-SSVSCTVS-RHL*LSPLPRQSNPHELASSCGAPNETQR 209 ++ P V +R +E P S V+C S RH+ + LP + L S+ G+ N QR Sbjct: 45 IVDDPLYVFRSWRFDDETPCSWRGVTCDASSRHVTVLSLPSSNLTGTLPSNLGSLNSLQR 104 Query: 208 L 206 L Sbjct: 105 L 105 >At4g35730.1 68417.m05071 expressed protein contains Pfam profile: PF03398 eukaryotic protein of unknown function, DUF292 Length = 430 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +3 Query: 321 DGGCSSCYRKSSCTHFGCWRRNSYF*SAGSSCSDWQEDSTGTRS 452 D SS Y K + G RR+SY + G + SD++E+ T T + Sbjct: 289 DSETSSYYAKPGAENRGMGRRHSYN-NPGINESDYEEEYTNTEA 331 >At1g32190.1 68414.m03959 expressed protein Length = 422 Score = 27.5 bits (58), Expect = 7.7 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 330 CSSCYRKSSCTHFGCWR 380 CSSC+ K C CW+ Sbjct: 359 CSSCFGKPKCPKCSCWK 375 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,314,195 Number of Sequences: 28952 Number of extensions: 315148 Number of successful extensions: 870 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 834 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 865 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -