BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B17 (615 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0300 + 27681204-27681656,27681745-27681840,27681933-276820... 31 0.73 10_08_0521 + 18500105-18500529,18501216-18501284,18501467-185015... 28 5.1 04_04_0072 + 22524974-22525310,22526334-22526552,22526826-225275... 27 8.9 02_05_0975 + 33227431-33227730,33228556-33228636,33228883-332296... 27 8.9 02_04_0317 + 21996324-21996681,21996833-21996859,21997299-219982... 27 8.9 >02_05_0300 + 27681204-27681656,27681745-27681840,27681933-27682022, 27682126-27682227,27682310-27682456,27683608-27683748, 27683749-27683808,27685133-27685230,27685308-27685410, 27685954-27686037 Length = 457 Score = 31.1 bits (67), Expect = 0.73 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +2 Query: 200 QEEGKLDNPQSENAALTVTGQYAYVAP-DGKHYTVTFTAGPNGFQPKTSL 346 Q E L P + AL V + + A DG+ F+A NGF+P SL Sbjct: 220 QAEMNLTGPTGQVYALAVGNELLFAATQDGRILAWRFSAATNGFEPAASL 269 >10_08_0521 + 18500105-18500529,18501216-18501284,18501467-18501555, 18501726-18501838,18502023-18502124,18502576-18502663, 18502795-18503361,18503766-18504149,18504168-18504384, 18504466-18504548,18505174-18505256,18505796-18506032, 18506481-18506658,18506814-18507328,18507740-18507916, 18508385-18508768,18508885-18509031 Length = 1285 Score = 28.3 bits (60), Expect = 5.1 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +2 Query: 173 YXTSDGTSRQEEGKLDNPQSENAAL---TVTGQYAYVAPDGKHYTVTFTAGPNG 325 Y S+G +++ ++DN +E A++ V+ AYV+P+ + T T +G Sbjct: 410 YLVSEGAQTKKQAQVDNETTEVASIHCCPVSNFSAYVSPEAAAQSATTTTWGSG 463 >04_04_0072 + 22524974-22525310,22526334-22526552,22526826-22527532, 22527664-22528482 Length = 693 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +2 Query: 137 DSNVEPDGYSFAYXTSDGTSRQEEGKLDNPQSENAALTVTGQY 265 D+++E D + Y + +E ++DNPQ E G+Y Sbjct: 391 DADLESDALGWQYISGSLPDGRELDRIDNPQLEGYKFDPHGEY 433 >02_05_0975 + 33227431-33227730,33228556-33228636,33228883-33229680, 33230829-33231005,33231159-33231274,33231422-33231520, 33231598-33232040,33232147-33232184,33232343-33232600, 33233378-33233525,33233989-33234108,33234884-33234984, 33235090-33235213,33235386-33235498,33236103-33236214, 33236298-33236432,33236527-33236593,33236685-33236741, 33236774-33236900,33237221-33237338,33237418-33237929 Length = 1347 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -3 Query: 286 AVRSYVSILSSNCQSCILGLWVVEFAFFLS--GCTITSXVRKAVAIGFH 146 A SY+ + C+ C+L L +V + L+ C+ITS + +A H Sbjct: 996 ACGSYLFTILQKCKECVLCLHIVTALYSLNVEQCSITSRTVQKMADALH 1044 >02_04_0317 + 21996324-21996681,21996833-21996859,21997299-21998227, 21998317-21999162 Length = 719 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +2 Query: 137 DSNVEPDGYSFAYXTSDGTSRQEEGKLDNPQSENAALTVTGQY 265 D+++E D + Y + +E ++DNPQ E G+Y Sbjct: 408 DADLESDALGWQYISGSLPDGRELDRIDNPQLEGYKFDPHGEY 450 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,230,045 Number of Sequences: 37544 Number of extensions: 309481 Number of successful extensions: 681 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 681 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1478421500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -