BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B17 (615 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 44 9e-07 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 9.6 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 44.4 bits (100), Expect = 9e-07 Identities = 24/64 (37%), Positives = 36/64 (56%), Gaps = 1/64 (1%) Frame = +2 Query: 155 DG-YSFAYXTSDGTSRQEEGKLDNPQSENAALTVTGQYAYVAPDGKHYTVTFTAGPNGFQ 331 DG Y + TS+G S QE G+ +E ++ G +Y APDG+ ++T+ A NGFQ Sbjct: 39 DGNYINNFETSNGISHQESGQPKQVDNETPVVS-QGSDSYTAPDGQQVSITYVADENGFQ 97 Query: 332 PKTS 343 + S Sbjct: 98 VQGS 101 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = +1 Query: 448 IIYPCHVQ*QKQFLISRAIWTLSFICTF 531 + YP + ++ L+ +W LSF+ F Sbjct: 171 VSYPQIMSPRRARLLVATVWILSFVICF 198 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,948 Number of Sequences: 438 Number of extensions: 3500 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -