BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B15 (721 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 22 4.4 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 22 4.4 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 22 4.4 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 21 7.6 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 21 7.6 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 22.2 bits (45), Expect = 4.4 Identities = 14/54 (25%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Frame = +1 Query: 397 NQKLLQHHC---YVNCPLKL*VTAYHIIFYHILSLKSLYQHCVFIVEIYIYLCY 549 N+ L+H+ +VN + + + F I+ LKS+ + + +EIY Y Sbjct: 89 NEPKLRHYLIFIFVNVFFWVIILMSNYAFTRIILLKSVLEIVIIDIEIYSQFLY 142 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 22.2 bits (45), Expect = 4.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 100 RLVSWTDSFNSNTHYLQ 50 R+ WTD +NSN + Q Sbjct: 499 RMKFWTDIYNSNPLFTQ 515 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 22.2 bits (45), Expect = 4.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 100 RLVSWTDSFNSNTHYLQ 50 R+ WTD +NSN + Q Sbjct: 501 RMKFWTDIYNSNPLFTQ 517 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/33 (24%), Positives = 16/33 (48%) Frame = -3 Query: 308 RKHSQESRLIWHAHLQTSLPHPHPSHGLLQIFR 210 + H+ +IW + L P +GLL++ + Sbjct: 342 KDHNMAGLMIWTVDMDDFLGLCGPKNGLLEVIK 374 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.4 bits (43), Expect = 7.6 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +2 Query: 350 LIFDVELLRLE*IQFVTKNYYNIIVMSIAL*NSKSQLITL 469 L VE R E I F+T+ Y+ + +AL ITL Sbjct: 42 LALGVERTRSELIPFLTETIYDEDEVLLALAEQLGSFITL 81 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,967 Number of Sequences: 336 Number of extensions: 3958 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19155320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -