BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B15 (721 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578802-1|AAT07307.1| 108|Anopheles gambiae FK506-binding prot... 180 3e-47 AY752910-1|AAV30084.1| 250|Anopheles gambiae peroxidase 15 prot... 24 4.1 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 24 4.1 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 24 4.1 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 24 5.4 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 7.2 >AY578802-1|AAT07307.1| 108|Anopheles gambiae FK506-binding protein protein. Length = 108 Score = 180 bits (439), Expect = 3e-47 Identities = 80/108 (74%), Positives = 92/108 (85%) Frame = +2 Query: 59 MGVTVETISPGDESTYPKSGQTVVVHYTGTLTNGKKFDSSRDRGKPFKFRIGKSEVIRGW 238 MGV + I+ GD++T+PK GQT VVHYTGTL +G FDSSR RGKPFKF +GK EVIRGW Sbjct: 1 MGVQIVPIANGDQTTFPKPGQTAVVHYTGTLDDGTVFDSSRTRGKPFKFSVGKGEVIRGW 60 Query: 239 DEGVAKMSVGERAKLTCSPDYAYGQQGHPGVIPPNSTLIFDVELLRLE 382 DEGVA+MSVG+RAKL CSPDYAYG +GHPGVIPPN+ L FDVELLR+E Sbjct: 61 DEGVAQMSVGQRAKLVCSPDYAYGSRGHPGVIPPNARLTFDVELLRVE 108 >AY752910-1|AAV30084.1| 250|Anopheles gambiae peroxidase 15 protein. Length = 250 Score = 24.2 bits (50), Expect = 4.1 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -2 Query: 402 LVTNCIYSRRRSSTSKISVELGGMTPGW 319 LV C+++ ++I+ ELG + P W Sbjct: 42 LVLTCMHTLLAREHNRIATELGKINPHW 69 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 24.2 bits (50), Expect = 4.1 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 328 SHTSQLYTYFRCRTSTSRINTICNQKLLQHHCYVNCP 438 SHT Q C S SRI+T+ + ++H +N P Sbjct: 545 SHTPQRSLCPYCPASYSRIDTLRSHLRIKHADRLNAP 581 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 24.2 bits (50), Expect = 4.1 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 328 SHTSQLYTYFRCRTSTSRINTICNQKLLQHHCYVNCP 438 SHT Q C S SRI+T+ + ++H +N P Sbjct: 521 SHTPQRSLCPYCPASYSRIDTLRSHLRIKHADRLNAP 557 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 23.8 bits (49), Expect = 5.4 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 392 FVTKNYYNIIVMSIAL*NSKSQLITLFFIT 481 FVT N IV+ I N + + +T FFIT Sbjct: 147 FVTAVIGNSIVLFIVQSNPRMRTVTNFFIT 176 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.4 bits (48), Expect = 7.2 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 5/37 (13%) Frame = -1 Query: 97 LVSWTDSFNSNTHY---LQCISLFFRDKD--PRXRNA 2 LV T S N NTHY L+C+ + R + P NA Sbjct: 21 LVLTTTSANENTHYLPPLECVDPYGRPQRCIPEFENA 57 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 732,372 Number of Sequences: 2352 Number of extensions: 15064 Number of successful extensions: 25 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -