BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B14 (396 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7SGA1 Cluster: Putative uncharacterized protein NCU027... 36 0.38 UniRef50_A4BQN8 Cluster: DNA polymerase III subunit delta; n=3; ... 33 2.0 UniRef50_Q9ZUN0 Cluster: Putative F-box protein At2g19630; n=1; ... 32 4.6 UniRef50_A7NDC7 Cluster: Major facilitator superfamily; n=10; Fr... 31 6.1 UniRef50_Q4X7K5 Cluster: Putative uncharacterized protein; n=1; ... 31 8.1 UniRef50_Q45V96 Cluster: Tentative cuticle protein; n=1; Myzus p... 31 8.1 UniRef50_A7T178 Cluster: Predicted protein; n=2; Nematostella ve... 31 8.1 UniRef50_A5K473 Cluster: Protein kinase domain containing protei... 31 8.1 >UniRef50_Q7SGA1 Cluster: Putative uncharacterized protein NCU02749.1; n=1; Neurospora crassa|Rep: Putative uncharacterized protein NCU02749.1 - Neurospora crassa Length = 526 Score = 35.5 bits (78), Expect = 0.38 Identities = 20/60 (33%), Positives = 29/60 (48%) Frame = +3 Query: 141 PATPFPTCHPYLYLPSTALHSPASTHKSHMQMIISFVNKMLK*IHTSGTSSVTINKIYCC 320 P PFP P+L PS + P STH ++VN L +T+G +V +K + C Sbjct: 158 PPRPFPP--PFLSPPSGSFSDPLSTHDRSRDRRAAYVNGKLIRGYTNGDDAVFASKYFVC 215 >UniRef50_A4BQN8 Cluster: DNA polymerase III subunit delta; n=3; Ectothiorhodospiraceae|Rep: DNA polymerase III subunit delta - Nitrococcus mobilis Nb-231 Length = 340 Score = 33.1 bits (72), Expect = 2.0 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +1 Query: 67 DRNAGSLRLRGGRPVCG-ASAVRCNCRLPPFLRVILICTYRL 189 +R LRL GG+P G A A++ CR PP ++L+ + RL Sbjct: 77 ERRLIELRLPGGKPGAGGAQALQAYCRAPPADTLLLVASARL 118 >UniRef50_Q9ZUN0 Cluster: Putative F-box protein At2g19630; n=1; Arabidopsis thaliana|Rep: Putative F-box protein At2g19630 - Arabidopsis thaliana (Mouse-ear cress) Length = 297 Score = 31.9 bits (69), Expect = 4.6 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 2/100 (2%) Frame = +3 Query: 27 LASDKLSKCLRRF*SQCWLSSPARRPTRMWCLCRTLQLPATPFP--TCHPYLYLPSTALH 200 L+ + +++C R S+ W S+ +R L R+L P F YL+L S L Sbjct: 29 LSVNSIARC--RCVSKQWASTLSRPYFTELFLTRSLARPKLLFAYRKGSDYLFLSSPQLQ 86 Query: 201 SPASTHKSHMQMIISFVNKMLK*IHTSGTSSVTINKIYCC 320 +P HK ++ VN + I T G+ +++ I CC Sbjct: 87 NPDDDHKKSSPVV---VNYHMHHILTLGSGNMSWRTIQCC 123 >UniRef50_A7NDC7 Cluster: Major facilitator superfamily; n=10; Francisella tularensis|Rep: Major facilitator superfamily - Francisella tularensis subsp. holarctica FTA Length = 418 Score = 31.5 bits (68), Expect = 6.1 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 2/65 (3%) Frame = +2 Query: 110 YVVPLPYAATAGYPLSYVS--SLSVPTVYSSAFTGFYPQIAYANDYIFRK*NVKVNTYIW 283 Y + L Y + L Y SL+V TV+S F+ P +DY+ RK +K + +I+ Sbjct: 248 YYLVLSYLSNHFVELHYSEFFSLAVVTVFSLIFSFSAPLWGLLSDYLGRKPLIKFSIWIY 307 Query: 284 NFFCY 298 F Y Sbjct: 308 LIFAY 312 >UniRef50_Q4X7K5 Cluster: Putative uncharacterized protein; n=1; Plasmodium chabaudi|Rep: Putative uncharacterized protein - Plasmodium chabaudi Length = 47 Score = 31.1 bits (67), Expect = 8.1 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +1 Query: 154 FLRVILICTYRLQLCIHRLLPTNRI 228 F I++C YRL +C+H+++ N I Sbjct: 14 FFSKIMVCIYRLLICLHQVIQQNHI 38 >UniRef50_Q45V96 Cluster: Tentative cuticle protein; n=1; Myzus persicae|Rep: Tentative cuticle protein - Myzus persicae (Peach-potato aphid) Length = 118 Score = 31.1 bits (67), Expect = 8.1 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +2 Query: 110 YVVPL-PYAATAGYPLSYVSSLSVPTVYSSAFTGFYPQIAYAND 238 Y P+ PYA +A YP SY + PT Y++ YP AYA+D Sbjct: 52 YSAPVYPYAYSA-YPYSYSYPAAYPTAYAA-----YPSYAYAHD 89 >UniRef50_A7T178 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 235 Score = 31.1 bits (67), Expect = 8.1 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +3 Query: 132 LQLPATPFPT--CHPYLYLPSTALHSPASTHKSHMQMIISFVNKMLK*IHTSGTSSVT 299 L P+TP PT C+ + Y PST P TH + ++ ++ +HT T +VT Sbjct: 110 LHTPSTPTPTHACYTHAYTPST----PTPTHAEYTH---AYTRRVHPRLHTPSTPTVT 160 >UniRef50_A5K473 Cluster: Protein kinase domain containing protein; n=2; Plasmodium|Rep: Protein kinase domain containing protein - Plasmodium vivax Length = 1278 Score = 31.1 bits (67), Expect = 8.1 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 79 GSLRLRGGR-PVCGASAVRCNCRLPPFLRVILICTYRLQLCIHRLLPTNR 225 G+L L GG P+CG + C LP + +C L +C ++ PT R Sbjct: 765 GTLPLCGGTLPLCGDALPLCGDALPLCGDALPLCGDTLPICAEKVFPTAR 814 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 313,463,069 Number of Sequences: 1657284 Number of extensions: 6068591 Number of successful extensions: 16443 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 15836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16430 length of database: 575,637,011 effective HSP length: 92 effective length of database: 423,166,883 effective search space used: 16503508437 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -