BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_B13 (754 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase p... 29 0.20 AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. 29 0.20 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 7.7 >AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase protein. Length = 557 Score = 28.7 bits (61), Expect = 0.20 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -1 Query: 658 IGLXTHEFLLDVLSDLSIVEEVAVFSDFPVDEENPLGKLLLRVQGFGQG 512 IG +H FL S ++ + D+PV N G+ +L VQ + G Sbjct: 250 IGGHSHSFLFPNASSKPHNQQDTILGDYPVVVSNANGRKILIVQAYAYG 298 >AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. Length = 557 Score = 28.7 bits (61), Expect = 0.20 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -1 Query: 658 IGLXTHEFLLDVLSDLSIVEEVAVFSDFPVDEENPLGKLLLRVQGFGQG 512 IG +H FL S ++ + D+PV N G+ +L VQ + G Sbjct: 250 IGGHSHSFLFPNASSKPHNQQDTILGDYPVVVSNANGRKILIVQAYAYG 298 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.4 bits (48), Expect = 7.7 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +2 Query: 320 NNYQTNREGFAKLFRKLSDDSWE 388 NN+QT + LFR + ++W+ Sbjct: 1346 NNFQTFPQAVLVLFRSATGEAWQ 1368 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 725,053 Number of Sequences: 2352 Number of extensions: 13908 Number of successful extensions: 25 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77755161 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -